KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01524Help
Entry
SAA6008_01524     CDS       T01886                                 

Gene name
mreB
Definition
(GenBank) ABC superfamily ATP binding cassette transporter, membrane protein
  KO
K09816  
zinc transport system permease protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
ABC transporters
Module
Zinc transport system
Brite
KEGG Orthology (KO) [BR:suk00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SAA6008_01524 (mreB)
Transporters [BR:suk02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    SAA6008_01524 (mreB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1637211..1638074)
Genome map
AA seq 287 aa AA seqDB search
MIDALLNFDFMRYSLISGILIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
IMPTLVFINPMWFGILFAIVGALLIEKLRTSYTAYQEIAIPIIMSAGIALSAIFISLADG
FNQEIVGLLFGSISAVNISDLTTIIVIAIIVVLFITLFYKELFILSFDEEYSKVIGIPKW
IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKSFKQLILLSVFLGELSVIL
GLVLAFYMDISPGGVIVVLLVILLMITMAYQKMRMKFKKGANINEYK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatgcattattgaattttgattttatgaggtactctttaattagtggtatcttg
ataggttttattgcgcctctaatcggtgcttttatcgttgttagacgactatcacttata
gctgatgctctaagtcatgtaactttaggtggtatatctttcggtatgtttttacttact
attatgccaacactagtatttattaatccaatgtggtttggaatcttattcgcaatagta
ggtgcgcttctaattgaaaaattaagaacgtcatacactgcttaccaagaaattgctatt
ccaattataatgagtgctggtatcgccttgagtgcaatcttcatttcattagctgatggg
ttcaatcaagaaattgttggattgctatttggctcaataagcgcagtgaatataagtgat
ttaacaacgattattgtcattgccatcatagttgttctgtttattacattgttttataaa
gaattatttatattgtcatttgatgaggaatatagtaaagtcattggcattcctaaatgg
attcaatttttatttattgttattgtagcgatggttatttctgcctcaatgcgtgttgta
gggatactgttagtaagtgcgttaatcacgttaccaattgcaataagtatgcgaataaca
aaaagttttaagcaattgatattactaagtgtatttttaggtgaattatcagtaatatta
ggcttagtcctagctttctatatggacatttctccgggtggtgtaattgtagttctactt
gttattttacttatgattacaatggcttatcagaaaatgcgaatgaagtttaaaaaggga
gctaatatcaatgaatacaaatga

DBGET integrated database retrieval system