KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01531Help
Entry
SAA6008_01531     CDS       T01886                                 

Gene name
dnaG
Definition
(GenBank) DNA primase
  KO
K02316  
DNA primase [EC:2.7.7.-]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
DNA replication
Brite
KEGG Orthology (KO) [BR:suk00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SAA6008_01531 (dnaG)
Enzymes [BR:suk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     SAA6008_01531 (dnaG)
DNA replication proteins [BR:suk03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SAA6008_01531 (dnaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1644628..1646427)
Genome map
AA seq 599 aa AA seqDB search
MRIDQSIINEIKDKTDILDLVSEYVKLEKRGRNYIGLCPFHDEKTPSFTVSEDKQICHCF
GCKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQSNSNVQIASDDLQMIEMHE
LIQEFYYYALTKTVEGEQALTYLQERGFTDALIKERGIGFAPDSSHFCHDFLQKKGYDIE
LAYEAGLLSRNEENFSYYDRFRNRIMFPLKNAQGRIVGYSGRTYTGQEPKYLNSPETPIF
QKRKLLYNLDKARKSIRKLDEIVLLEGFMDVIKSDTAGLKNVVATMGTQLSDEHITFIRK
LTSNITLMFDGDFAGSEATLKTGQNLLQQGLNVFVIQLPSGMDPDEYIGKYGNDAFTAFV
KNDKKSFAHYKVSILKDEIAHNDLSYERYLKELSHDISLMKSSILQQKALNDVAPFFNVS
PEQLANEIQFNQAPANYYPEDEYGGYIEPEPIGMAQFDNLSRQEKAERAFLKHLMRDKDT
FLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQYNISDAVQYVNSNELRETLISLEQYN
LNDEPYENEIDDYVNVINEKGQETIESLNHKLREATRIGDVELQKYYLQQIVAKNKERM
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaatagatcaatcgatcattaatgaaataaaagataaaaccgacattttagacttg
gtaagtgaatatgtaaaattagaaaagagaggacgcaattatataggtttgtgtcctttt
catgatgaaaagacaccttcatttacagtttctgaagataaacaaatttgtcattgtttt
ggttgtaaaaaaggtggcaatgtttttcaatttactcaagaaattaaagacatatcattt
gttgaagcggttaaagaattaggtgatagagttaatgttgctgtagatattgaggcaaca
caatctaactcaaatgttcaaattgcttctgatgatttacaaatgattgaaatgcatgag
ttaatacaagaattttattattacgctttaacaaagacagtcgaaggcgaacaagcatta
acgtacttacaagaacgtggttttacagatgcgcttattaaagagcgaggcattggcttt
gcacccgatagctcacatttttgtcatgattttcttcaaaaaaagggttacgatattgaa
ttagcatatgaagccggattattatcacgtaacgaagaaaatttcagttattacgataga
tttcgaaatcgtattatgtttcctttgaaaaatgcgcaaggaagaattgttggatattca
ggtcgaacatataccggtcaagaaccaaaatacttaaatagtcctgaaacacctatcttt
caaaaaagaaagttgttatacaacttagataaagcgcgtaaatcaattagaaaattagat
gaaatcgtattactagaaggttttatggatgttataaaatctgatactgctggcttgaaa
aacgttgttgcaacaatgggtacacagttgtcagatgaacatattacttttatacgaaag
ttaacatcaaatataacattaatgtttgatggggattttgcgggtagtgaagcaacactt
aaaacaggtcaaaatttgttacagcaagggctaaatgtatttgttatacaattgccatca
ggcatggatccggatgaatacattggtaagtatggcaacgatgcatttactgcttttgta
aaaaatgacaaaaagtcatttgcacattataaagtgagtatattaaaagatgaaattgca
cataatgacctttcatatgaacgttatttgaaagaactaagtcatgatatttcgcttatg
aaatcatcgattttgcaacaaaaggctttaaatgatgttgcaccatttttcaatgttagt
cctgagcaattagctaacgaaatacaattcaatcaagcaccagccaattattatccagaa
gatgagtatggcggttacattgaacctgagccaattggtatggcacaatttgacaatttg
agccgtcaagaaaaagcggagcgagcatttttaaaacatttaatgagagataaagataca
tttttaaattattatgaaagtgttgataaggataacttcacaaatcagcattttaaatat
gtattcgaagtcttacatgatttttatgcggaaaatgatcaatataatatcagtgatgct
gtgcagtatgttaattcaaatgagttgagagaaacactaattagcttagaacaatataat
ttgaatgacgaaccatatgaaaatgaaattgatgattatgtcaatgttattaatgaaaaa
ggacaagaaacaattgagtcattgaatcataaattaagggaagctacaaggattggcgat
gtagaattacaaaaatactatttacagcaaattgttgctaagaataaagaacgcatgtag

DBGET integrated database retrieval system