KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01532Help
Entry
SAA6008_01532     CDS       T01886                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09773  
[pyruvate, water dikinase]-phosphate phosphotransferase / [pyruvate, water dikinase] kinase [EC:2.7.4.28 2.7.11.33]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Enzymes [BR:suk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.28  [pyruvate, water dikinase]-phosphate phosphotransferase
     SAA6008_01532
   2.7.11  Protein-serine/threonine kinases
    2.7.11.33  [pyruvate, water dikinase] kinase
     SAA6008_01532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1646488..1647306)
Genome map
AA seq 272 aa AA seqDB search
MEKIKIIVASDSIGETAELVARAGISQFNPKQCKNELLRYPYIESFEDVDEVIQVAKDTN
AIIVYTLIKPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAY
FKKIDAIEFAVKYDDGKDPKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEV
TPPDGLYDINPKKCIALKISEEKLNRIRKERLKQLGLGDTARYATEARIQEELNYFEEIV
SEIGCPVIDVSQKAIEETANDIIHYIEQNKSK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattaaaattatcgtagcttcagattctataggtgaaacggcagagttagtt
gctagggcaggtatttcacaattcaatcctaagcaatgtaaaaatgaattattaagatat
ccatatattgaatcttttgaagatgttgatgaagtgattcaagttgcaaaagatacaaat
gctatcattgtttatacacttattaaacctgaaatgaagcaatatatgagtgagaaagta
gcagaattccaattgaagtctgtcgatatcatggggccattaatggatttattatctgct
tcggttgaagaaaaaccttataatgagccaggtatcgttcatagattagatgatgcatat
ttcaagaaaattgatgcgatagagtttgcagttaaatatgatgatggtaaagatcctaaa
ggattacctaaagctgatattgttttacttggtatttcgagaacttcaaagacaccatta
tctcagtatttagcgcataagagttacaaagttatgaatgtaccgattgtaccagaagtg
acaccgccagatggcttatatgatattaatccaaagaaatgtatcgcacttaaaataagt
gaagaaaaattaaatcgcattagaaaagagcgactaaaacaattaggactaggtgacaca
gctcgatatgcaacagaagcacgaattcaagaagaattgaattactttgaagaaatcgta
agtgaaattggatgtcctgtcattgatgtttctcaaaaagcaatcgaagaaacagcaaac
gatataatccattatattgaacaaaataaatcgaaatga

DBGET integrated database retrieval system