KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01538Help
Entry
SAA6008_01538     CDS       T01886                                 

Gene name
cdd
Definition
(GenBank) cytidine deaminase, homotetrameric
  KO
K01489  
cytidine deaminase [EC:3.5.4.5]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAA6008_01538 (cdd)
Enzymes [BR:suk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     SAA6008_01538 (cdd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1651488..1651892)
Genome map
AA seq 134 aa AA seqDB search
MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASL
VSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTV
AELLPFGFSGKDLE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcaacctcattattttcaagaagttagaaaagcacaacaagaatcatattcg
ccatacagtcaatttaaagtaggggcttatttaaaaacgaaagacggtagaactttttat
ggtaccaatgtagaaaatgcttcttatccattatcgatatgtgctgaacgagctagtttg
gtatcggcaatttctcaaggatacagaccaggtgattttgaatcaataactgtaaccgta
gatgcagataaaccgtcatcaccttgtggtgcatgtcgtcaagttttgaaggaattatgt
gatgatgatatgcctgtgtatatgacaaatcataaaggagatatggttatgatgacagtc
gcagagttactaccatttggattttcaggaaaggatttagaataa

DBGET integrated database retrieval system