KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01539Help
Entry
SAA6008_01539     CDS       T01886                                 

Gene name
dgkA
Definition
(GenBank) diacylglycerol kinase
  KO
K00887  
undecaprenol kinase [EC:2.7.1.66]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAA6008_01539 (dgkA)
Enzymes [BR:suk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.66  undecaprenol kinase
     SAA6008_01539 (dgkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1651903..1652247)
Genome map
AA seq 114 aa AA seqDB search
MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEA
LNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggtttaaatatgcacttgatgggctgaaaatcttaattcaaaaagactataaa
tttcttttacatgtgtttgcaatgattgttgctattgtctttggtctcgtactaaatatt
aatcggattgagtggatatttatactcattgctattgcattagttctcactgttgaagct
ttaaacactgctattgaatatgttgtcgatttagtgaccgttgaatatcatgatttagct
aaatacgctaaagatattgcggcttttagtgtacttatagtttcaatattagcatttatt
ataggtttaatagtatttttaccacattttatagcgttattttag

DBGET integrated database retrieval system