KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01540Help
Entry
SAA6008_01540     CDS       T01886                                 

Definition
(GenBank) putative metalloprotease
  KO
K07042  
probable rRNA maturation factor
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Ribosome biogenesis [BR:suk03009]
 Prokaryotic Type
  Other maturation factors
   SAA6008_01540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1652250..1652717)
Genome map
AA seq 155 aa AA seqDB search
MFTIDFSDHTGLVKDAWYKQIEDLLEFAKKEEHIEDDAELSVTFVDKQEIQEINRTYRDK
DKVTDVISFALEEDEPEIDFSGLDIPRVLGDIIICTDVAQEQANNYGHSFERELGFLALH
GFLHLLGYDHMTEADEKEMFGRQDTILNAYGLTRD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgatagattttagcgatcacacaggcttagttaaagatgcttggtataaacaa
attgaagatttattagaatttgctaaaaaagaagagcatatagaagacgatgctgagctt
tctgttacatttgtagataaacaagaaatacaagaaattaatcgaacatatagagataaa
gataaagttacagatgtaatctcatttgctttagaagaagatgagccagagattgatttt
agtggtcttgatataccacgtgttttaggggatataattatctgtacggatgtagcgcaa
gaacaagcaaacaattacggacattcttttgaacgagaattaggatttttagcattacat
ggatttttgcatctattaggttatgatcatatgactgaagcggatgaaaaggaaatgttt
ggtcgacaagatacaatattaaacgcatatggattaacacgagactaa

DBGET integrated database retrieval system