KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01547Help
Entry
SAA6008_01547     CDS       T01886                                 

Gene name
rsmE
Definition
(GenBank) 16S ribosomal RNA methyltransferase RsmE
  KO
K09761  
16S rRNA (uracil1498-N3)-methyltransferase [EC:2.1.1.193]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Enzymes [BR:suk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.193  16S rRNA (uracil1498-N3)-methyltransferase
     SAA6008_01547 (rsmE)
Ribosome biogenesis [BR:suk03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    SAA6008_01547 (rsmE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1658440..1659192)
Genome map
AA seq 250 aa AA seqDB search
MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK
IEVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE
AKAAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE
LSNFKQTLQQFNAQDKVLMIFGPEGGLSENEISLFSNTSTVVGLGPRILRAETAPLYALS
AISYEKELMG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacgttatttcatagaccaaaacgctgatgtaagtcagcgtttttttattacaaaa
aaagaagatattcatcatataacaaatgtaatgagatatgatgttggtagtaaaattatt
ttaacttttaatgatcaaacagtttatttatgtgaaattgctgacataacaagtgataaa
attgaagttgatttaaaagaaaaacaaaatattaatacagaattgccagttgatgttacg
atttgcagtggactaatcaaagctgacaaatatgagtggttgctacaaaaagctactgaa
ttgggtgcttcatcatttatagctgtgagcatggaacgttcaattgttaaattaaacgag
gcaaaagctgccaaaaagatagagcgttggcaaaaaataattaaagaagctgctgaacaa
agctatcgtttagtgattccatctattcaattcgagtcgaatttaaaattaatttgtgat
actattgataattatgactatattcttattgcatatgaagaggaagcaaaagatggtgag
ttaagcaatttcaagcaaactttacaacaattcaatgctcaggataaagtgttgatgatt
tttggtcctgagggtggtttgtcagaaaatgaaatttcattatttagtaatactagtaca
gttgttggtcttgggccgagaattttacgggcagaaactgcgccattgtatgcgttaagt
gcaataagttatgaaaaagaattaatggggtga

DBGET integrated database retrieval system