KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01548Help
Entry
SAA6008_01548     CDS       T01886                                 

Gene name
prmA
Definition
(GenBank) ribosomal protein L11 methyltransferase
  KO
K02687  
ribosomal protein L11 methyltransferase [EC:2.1.1.-]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Enzymes [BR:suk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SAA6008_01548 (prmA)
Ribosome biogenesis [BR:suk03009]
 Prokaryotic Type
  ribosomal protein modification factors
   SAA6008_01548 (prmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1659194..1660132)
Genome map
AA seq 312 aa AA seqDB search
MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDDLINQPEDKYGEIYALKKEDYPDK
GVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNVQFSEQIIAETDWENEWKNYFHPFR
ASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDV
GTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKF
DIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDN
GWVCLVGQKVSE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaactggacagagctttcaattattattaatcatgaagcagtagaattggctaccaat
atacttgaaaatcatggatcaaatggtgtcgtgatagaagattcagatgatttaattaac
caaccagaagataaatacggtgaaatttacgctttgaaaaaagaggattatccagataag
ggagtaagattgaaagcctattttaatgaaatgacttatgatgataagttgcgacagcaa
attaaagatgagttattaaatttagatgaacttgatcaacataacgttcaattcagtgag
caaattattgcagagacggattgggaaaatgaatggaaaaactatttccatccattccga
gcgtcgaagaagttcacaatagttcctagttgggaaacatatgctaaagaagcggatgaa
gagctttgcattgagctcgacccaggtatggcttttggaacaggtgatcatccgactaca
agtatgtgtttgaaggcaatagaaacatatgtattgccacagcattcagtaattgatgtt
ggtactggctcaggtatattaagtattgcaagtcatctaatcggtgtaaaacgtattaaa
gcgttggatattgatgaaatggcagtgagtgtagctaaagaaaacttcagaagaaatcat
tgtgaaacgttaattgaagctgttccaggtaacttattgaaagacgaaacagaaaaattt
gatattgtaatagcaaatattttagcgcatattattgatgaaatgattgaagatgcttat
aatactctaaatgaaggcggttattttattacttctggtattataaaagagaagtatgaa
ggtatacagtcacatatggagcgtgtaggttttaaaattatttcagaacaacatgacaac
ggttgggtttgtcttgttggccagaaagtgagtgaataa

DBGET integrated database retrieval system