KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01550Help
Entry
SAA6008_01550     CDS       T01886                                 

Gene name
dnaK
Definition
(GenBank) molecular chaperone DnaK
  KO
K04043  
molecular chaperone DnaK
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:suk00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SAA6008_01550 (dnaK)
Messenger RNA biogenesis [BR:suk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     SAA6008_01550 (dnaK)
Chaperones and folding catalysts [BR:suk03110]
 Heat shock proteins
  HSP70 / DNAK
   SAA6008_01550 (dnaK)
Mitochondrial biogenesis [BR:suk03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    SAA6008_01550 (dnaK)
  Matrix
   MMC/PAM proteins
    SAA6008_01550 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SAA6008_01550 (dnaK)
Exosome [BR:suk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAA6008_01550 (dnaK)
  Exosomal proteins of breast cancer cells
   SAA6008_01550 (dnaK)
  Exosomal proteins of colorectal cancer cells
   SAA6008_01550 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1661411..1663243)
Genome map
AA seq 610 aa AA seqDB search
MSKIIGIDLGTTNSCVTVLEGDEPKVIQNPEGSRTTPSVVAFKNGETQVGEVAKRQAITN
PNTVQSIKRHMGTDYKVDIEGKSYTPQEISAMILQNLKNTAESYLGEKVDKAVITVPAYF
NDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDKDEKVLVFDLGGGTFDVSILE
LGDGVFEVLSTAGDNKLGGDDFDQVIIDYLVAEFKKENGVDLSQDKMALQRLKDAAEKAK
KDLSGVSQTQISLPFISAGENGPLHLEVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGLT
NSDIDEVILVGGSTRIPAVQEAVKKEIGKEPNKGVNPDEVVAMGAAIQGGVITGDVKDVV
LLDVTPLSLGIEILGGRMNTLIERNTTIPTSKSQIYSTAIDNQPSVDVHVLQGERPMAAD
NKTLGRFQLTDIPPAERGKPQIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDE
EIDRMVKDAEVNAEADKKRREEVDLRNEADSLVFQVEKTLTDLGENIGEEDKKSAEEKKD
ALKTALEGQDIEDIKSKKEELEKVIQELSAKVYEQAAQQQQQAQGANAGQNNDSTVEDAE
FKEVKDDDKK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattattggtatagacttaggtacaacaaattcatgtgtaacagtattagaa
ggcgatgagccaaaagtaattcaaaaccctgaaggttcacgtacaacaccatctgttgta
gctttcaaaaatggagaaactcaagttggtgaagtagcaaaacgtcaagctattacaaac
ccaaacactgttcaatctattaaacgtcatatgggtactgattataaagtagatattgaa
ggtaaatcatacacaccacaagaaatctcagctatgattttacaaaacttaaaaaataca
gctgaaagctatttaggtgagaaagttgacaaagctgtaattacagtacctgcatacttt
aacgatgctgaacgtcaagcaactaaagatgctggtaaaattgctggtttagaagttgag
cgtatcattaatgaaccaacagctgcagcattagcatatggtttagacaaaactgataaa
gatgaaaaagttcttgtttttgacttaggtggcggtacatttgacgtatctatcctagaa
ttaggtgacggtgtattcgaagtactatcaacagccggtgacaacaaacttggcggtgat
gattttgaccaagtaattattgactacctagttgcagaattcaaaaaagaaaatggcgta
gacttatctcaagataaaatggcattacaacgtttgaaagatgctgctgaaaaagctaaa
aaagacttatcaggtgtatcacaaactcaaatctcattaccatttatctcagctggtgaa
aacggtccattacacttagaagtaaacttaactcgttctaaatttgaagaattatcagat
tcattaattagaagaacaatggaacctacacgccaagcaatgaaagacgctggcttaaca
aactcagatatcgatgaagttatcttagttggtggatcaactcgtattccagcagtacaa
gaagctgtcaaaaaagaaatcggtaaagagcctaacaaaggagtaaacccggacgaagta
gtggcaatgggagctgcaatccaaggtggcgttatcacaggtgacgttaaagacgtagta
ttattagacgtaacaccactatctttaggtattgaaattttaggtggacgtatgaatacg
ttaattgaacgtaacactacgattcctacatctaaatctcaaatctattcaacagcaata
gataatcaaccatcagtagatgtacacgtattacaaggtgaacgtccaatggctgcggat
aataaaacacttggtagattccaattgactgatattccaccagctgaacgtggtaaacct
caaattgaagtaacgtttgatatcgataaaaacggtattgtaaatgtaactgcaaaagac
ttaggtacaaataaagaacaaagaattacaattcaatcaagttcttcattatcagacgaa
gaaatcgaccgtatggtaaaagatgctgaagttaacgctgaagcagataaaaaacgtcgt
gaagaagtagacttaagaaacgaagctgacagtctagtattccaagttgaaaaaacttta
actgatttaggcgaaaatatcggtgaagaagataaaaaatctgctgaagagaaaaaagac
gctcttaaaactgctttagaaggtcaagatatagaagatattaaatctaaaaaagaagaa
cttgaaaaagtgattcaagaattatcagcaaaagtatatgagcaagcggctcaacagcaa
caacaagcacaaggtgctaatgctggtcaaaacaatgatagtactgtagaagatgctgaa
tttaaagaagtaaaagacgacgacaaaaaataa

DBGET integrated database retrieval system