KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01556Help
Entry
SAA6008_01556     CDS       T01886                                 

Gene name
holA
Definition
(GenBank) DNA polymerase III delta subunit
  KO
K02340  
DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAA6008_01556 (holA)
   00240 Pyrimidine metabolism
    SAA6008_01556 (holA)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SAA6008_01556 (holA)
   03430 Mismatch repair
    SAA6008_01556 (holA)
   03440 Homologous recombination
    SAA6008_01556 (holA)
Enzymes [BR:suk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAA6008_01556 (holA)
DNA replication proteins [BR:suk03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAA6008_01556 (holA)
DNA repair and recombination proteins [BR:suk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SAA6008_01556 (holA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1669200..1670174)
Genome map
AA seq 324 aa AA seqDB search
MSDNIVAIYGDVPELVEKQSAEIISQFLKSDRDDFNFVKYNLYETEIAPIVEETLTLPFF
SDKKAILVKNAYIFTGEKAPKDMAHNVDQLIEFIEKYDGENLIVFEIYQNKLDERKKLTK
TLKKHARLKKIEQMSEEEIKKWIQSKLNENFKDIKRDALDLFIELTGINFNIVSQEIEKL
ILFLGDRPTINKQDVNQIINRSLEQNVFLLTEYIQKRKKEQAIHLVKDLITMKEEPIKLL
ALITSNYRLFYQCKILSQKGYSGQQIAKTIGVHPYRVKLALGQVRHYQLDELLNIIDACA
ETDYKLKSSYMDKQLILELFILSL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatattgtagctatttatggagatgtgcctgaattggttgaaaaacaaagt
gcagaaatcatatcacaatttttgaaaagtgatagagatgactttaactttgtgaaatat
aatttatacgaaacagagattgcaccaattgttgaagaaacattaacattgcctttcttt
tcagataaaaaagcaattttggttaaaaatgcatatatatttacaggtgaaaaagcgcca
aaagatatggctcataatgtagatcaattaatagaatttattgaaaaatatgatggcgaa
aatttgattgtctttgagatatatcaaaataaacttgatgaaagaaaaaagttaactaaa
actctaaaaaagcatgcaaggcttaaaaaaatagagcaaatgtctgaagaagaaataaaa
aaatggattcaaagtaaattaaatgagaatttcaaagatatcaaaagagatgcattagat
ttatttattgagttgacaggtattaactttaatattgtctcacaagagatagaaaagttg
attttatttttaggcgatagaccaacaattaataagcaggatgttaaccaaattattaat
agaagtttagagcaaaatgtatttttactgactgaatacattcagaaaagaaagaaagaa
caagcaattcatttagtaaaagatttaataactatgaaagaagaaccaattaaattactt
gcactaattacaagtaattaccgattattttatcaatgtaagattctgagtcaaaaagga
tatagtggacagcaaattgctaaaacaataggagtacatccatacagagtaaaattagcg
ttaggacaagtaagacattatcaacttgatgaattattgaatattatagatgcttgtgcg
gaaactgattataaacttaaatcatcatatatggataaacagttaatactggaattattc
attctatctttataa

DBGET integrated database retrieval system