KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01559Help
Entry
SAA6008_01559     CDS       T01886                                 

Gene name
comEB
Definition
(GenBank) late competence operon required for DNA binding and uptake comEB
  KO
K01493  
dCMP deaminase [EC:3.5.4.12]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Competence-related DNA transformation transporter
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAA6008_01559 (comEB)
Enzymes [BR:suk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.12  dCMP deaminase
     SAA6008_01559 (comEB)
Secretion system [BR:suk02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   SAA6008_01559 (comEB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1672437..1672898)
Genome map
AA seq 153 aa AA seqDB search
MERIKWEEYFMAQSHLLALRSTCQRLSVGATIVKDNRIIAGGYNGSVAGEVHCIDEGCLI
EDGHCIRTIHAEMNALLQCAKQGVSTEGATIYVTHFPCLNCTKSIIQAGIKRIYYAEDYH
NHEYATKLLKQSGIEFKKIPFSPEYVAKYLTKG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagaatcaaatgggaagaatattttatggcacaaagtcatttgctagcattacgt
tcaacttgtcaaagattatctgtaggtgcaacgattgttaaggataatcgtattattgct
ggtggttataatggctctgtagctggcgaggtgcattgtatagatgaaggatgtttaatt
gaagatggacattgtatcagaacgatacatgcagaaatgaatgctttattacaatgtgca
aaacaaggtgtatctactgaaggtgcaacaatctatgttactcattttccatgcctaaat
tgtacaaagtcaattattcaagcaggtataaagcgtatctactatgcagaagattatcat
aaccatgaatatgcaactaaattactcaaacaatctggtattgaatttaaaaaaattcca
ttttcaccagaatatgttgctaaatatctgactaaaggttaa

DBGET integrated database retrieval system