KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01573Help
Entry
SAA6008_01573     CDS       T01886                                 

Definition
(GenBank) conserved hypothetical protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1681334..1682554)
Genome map
AA seq 406 aa AA seqDB search
MGYRTLKSIFHEHNESKMKEEYIKRFNSLASFNTNINIIPMENGKKVNDLEYPLFFMVTK
NLSKKQELISINSRKIDRALNSLPYAAREQYFNDLLIDELQSTNEIENVFSTKQEIAHAL
NNQASEFLKFRGLVDQYKEIELNKKIKVDNVRDIRAIYDKLVSNEINEQDKLDGELFRKN
FVGVHDGSTNKHIHVGLQPETKIVEFIGEMLTFLKYFDAPQPFKIMASHYLFEYIHPFYD
GNGRVGRFIIAKLLSDYYDNYTALTFSYVINRNKSKYYKAFMTASNHLNCGDLTEFIDTM
LELLIAGQERILDELIPKMDATEKLTLYLTSHYKQIDYEFLYLLSMDKLFGNKRNRLTLI
DLENILGVGRVKINNTIKKYDNYLVKIKSRPTIYEISDEFLNSIIK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggttacagaactttaaaaagtatttttcatgaacacaatgaaagtaaaatgaaggaa
gagtatattaaaagatttaattctttagcttctttcaatactaatattaatatcatacct
atggaaaatggaaaaaaagttaatgatttggaatatcctctattctttatggtgactaaa
aatctatcaaaaaaacaagaattaatatcaattaatagtagaaaaattgatagagcactt
aattctttaccatatgcagctagagaacaatattttaatgatttattaatcgatgaatta
caaagtactaatgaaattgaaaatgtatttagtactaaacaagagattgcacatgcgtta
aataaccaagcatcagaatttcttaagttcagaggcctcgtggatcaatataaagagata
gaacttaataaaaaaattaaagttgataatgtaagagacattagagcgatttatgataaa
ttagtttcaaatgaaattaacgaacaagataagttagatggagagctatttcgtaaaaat
tttgtcggtgtgcatgatgggtcaacgaataaacatatacatgttgggttacaacctgaa
accaaaattgttgaatttataggtgaaatgctaacatttttaaaatattttgatgcgcct
cagccgttcaaaatcatggctagtcattatctgtttgaatatatacatcctttttatgat
ggcaatggtagagttggaagatttataattgccaagctcttgagtgattattatgataat
tatactgctttgacattttcatatgttataaatagaaataaatcgaaatattacaaggcg
tttatgactgcttcaaatcatttgaattgtggtgatttgacggaatttattgacacaatg
cttgagctattgatagcaggacaagaaagaatacttgatgagttaataccaaaaatggat
gcgactgaaaaattaacgctttatttaactagtcattataaacagatagattatgaattt
ttgtatctcctttcaatggataaattgtttggaaataaaagaaatagattaacattaatt
gatttagaaaacatattgggagtaggaagagtaaaaattaataatacaattaaaaaatat
gataactacttagttaaaattaaaagtagaccaacaatttatgagataagtgatgaattt
ctaaattcgattataaaataa

DBGET integrated database retrieval system