KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01577Help
Entry
SAA6008_01577     CDS       T01886                                 

Gene name
accB_1
Definition
(GenBank) acetyl-CoA carboxylase biotin carboxyl carrier protein subunit, Acc_B1
  KO
K02160  
acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAA6008_01577 (accB_1)
   00640 Propanoate metabolism
    SAA6008_01577 (accB_1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SAA6008_01577 (accB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1686212..1686661)
Genome map
AA seq 149 aa AA seqDB search
MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASK
ANDNSDVSTNDYHDIKSPMIGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEV
TTDVAGEITEIVADHGTNVEYDQVLVRIK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaaaaaatcgaacaaataatcaaattagtgaaggaaaatgatgttaagaaa
tttaaatataaaaattttgaagatgaaatagaaattgacttcactgactcgaatcatttg
gctgcacacagtaatcaatcaaatcaaagtatgaacaataatgatttgacagcttcaaaa
gcgaatgataactccgatgtttcgacaaatgattatcatgacattaaatcaccaatgata
ggtacattctttttacaagatagtaaagaattaactgaaccaattgtgaatgtcggtgac
aaagttaacaagggagatattataggatatgttgaagcgatgaaagtattaaacgaggta
acaacagatgttgctggagaaattactgaaatagtagctgatcatggcacaaatgttgaa
tacgaccaagttttggtacgtattaagtaa

DBGET integrated database retrieval system