KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01597Help
Entry
SAA6008_01597     CDS       T01886                                 

Gene name
rarA
Definition
(GenBank) DNA-directed DNA polymerase III gamma and tau subunits
  KO
K07478  
putative ATPase
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1705434..1706708
Genome map
AA seq 424 aa AA seqDB search
MSTEPLASRMRPKNIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAI
SGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGK
IVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDE
DAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDM
HYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTL
AAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDG
HYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNLL
KQRP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacagaaccattagcatcgagaatgcgcccaaaaaatatagatgaaatcatttcc
caacaacatttagttggaccaagaggcattatcagaagaatggttgatacaaaaaaatta
acttcaatgattttttatggtccacctggtataggcaaaacaagtattgccaaagcaatt
tcgggcagtacgcaatataaattcagacaattgaatgctgtaactaacactaaaaaagat
atgcaacttgttgttgaagaagctaaaatgtctggtcaagttatcttgttattagatgaa
atacatcgactagataaagctaaacaagactttttattacctcatttagaaaatggcaaa
atcgtcttgatcggtgctacaacttcaaatccttatcatgctatcaatccagcgattcgt
tcaagagcgcaaattttcgagttatatcctttaaatgacgaagatgtgcgccaagcgtta
actcgtgcaatagaagatgatgagaatggtttgaaaacatatcaacccaaaattgatgaa
gatgccatgacctacttttctacacaaagccaaggtgatgttcgtagtgcgttaaatgca
ttggaattagctgtattaagcgcagataatgacaaagacggttatcgacatgttacattg
caagatgctaaagactgtttacaaaaaggtgcatttgtaagtgacaaggatggtgacatg
cattacgatgttatgagcgctttccaaaaatctatccgtggtagcgacgtcaatgccgct
ttacattatttagcacgattaattgaagctggagatttacctacaatagttcgacgatta
cttgtaattagctatgaggatataggcttagcctcacctaatgctggtcagagaacactt
gctgctattgaatcagcagaacgtctaggtttaccagaagctagaattccactaagccaa
gcagtaatcgaactatgcttatcacctaagtcaaattcagcaatgagtgccattgatagt
gcattgtccgatattagaaacggtcatgtgggccaaattccaaaccatttaaaagatgga
cattatcaaggtgctaaagatctaggccgatctattggttacaaatatccacaccaatat
gttaatggctatgtttcacagcaatatttacctgataaactaaaaaacaaaatttattac
gaaccaaaaacgacatctaaaagtgaacaacaactcaaagaaatatataacaacttactt
aaacaaaggccgtaa

DBGET integrated database retrieval system