KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01598Help
Entry
SAA6008_01598     CDS       T01886                                 

Definition
(GenBank) ThiF family protein
  KO
K22132  
tRNA threonylcarbamoyladenosine dehydratase
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Transfer RNA biogenesis [BR:suk03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    SAA6008_01598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1706869..1707642)
Genome map
AA seq 257 aa AA seqDB search
MKHQFSRNELAIGQQGLDLLKQQTVVILGVGGVGSFAAEALARTNIGHIILIDKDDVDIT
NVNRQLHALTTTVGQSKVSLMEERIKLINPDCKVTPLHMFYTEETYEEIFDNYDIDYFVD
ASDTIMYKVHLMKECLDRGIKVISSMGAANKTDPTRFTISDISKTHTDPMAKIIRQKLKK
LGIRKGIPVVFSDESPIVIREDVKDIVGDKNAINRKGQMPPSSNAFVPSVVGLICASYVV
NDVLKDIPVRRIKDKGQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcaattttcaagaaatgaactagcgattggacaacaaggtttagatttattg
aagcaacaaactgttgtcatacttggcgttggaggtgttggttcatttgctgctgaagca
ttagcaagaacgaatattggtcatattatattaatagataaagatgatgttgatattaca
aatgtaaacagacaattacacgctttaactacaacggtaggacaaagtaaagtttctttg
atggaagaacgtattaaattaattaatccagattgtaaagtcacgcccttacatatgttt
tatacagaagagacatatgaagaaattttcgataactacgatatagattattttgtagat
gcaagtgatacaataatgtacaaagtacacttaatgaaagagtgtcttgaccgagggatt
aaagtgatttccagtatgggtgctgcaaataaaacagatccaacacgttttacaatttca
gatatctctaaaacacataccgatccaatggccaaaattattcgtcaaaaattgaaaaaa
ctaggaattcgtaaagggattccagttgtattttcagatgaaagtccaattgtcataaga
gaagatgtaaaagatatagttggagataaaaatgctatcaatcgaaaaggacaaatgcca
ccttcttcaaatgcctttgtgccaagtgttgttggattaatttgtgcaagttatgtggtg
aatgacgtattaaaagatattccagttcgtcgcattaaagacaaagggcaataa

DBGET integrated database retrieval system