KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01600Help
Entry
SAA6008_01600     CDS       T01886                                 

Gene name
hisS
Definition
(GenBank) histidyl-tRNA synthetase
  KO
K01892  
histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:suk00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAA6008_01600 (hisS)
Enzymes [BR:suk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     SAA6008_01600 (hisS)
Amino acid related enzymes [BR:suk01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   SAA6008_01600 (hisS)
Transfer RNA biogenesis [BR:suk03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SAA6008_01600 (hisS)
 Prokaryotic Type
    SAA6008_01600 (hisS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1709885..1711147)
Genome map
AA seq 420 aa AA seqDB search
MIKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVV
QKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMQGNPNQPIKLYYNGPMFRYERKQKGR
YRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALV
KHFEPVIHEFCSDCQSRLHTNPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKA
YLDDLGIPYIEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPS
ETGIGFALSIERLLLALEEEGIELDIEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKAD
KDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatacctagagggacgcaggatattttacctgaagattcaaagaaatggcgt
tacattgaaaatcaattagatgaattaatgacattttataattataaagaaataagaaca
ccaatttttgaaagtacagatctttttgcaagaggtgttggtgattcaaccgatgtcgta
caaaaagaaatgtatacatttaaagataaaggcgatagaagtattacattaagacctgag
ggaacagctgcagttgtgcgttcatatattgaacataaaatgcaaggtaatccaaaccaa
ccaattaaactttattacaatggaccgatgtttagatatgaacgtaagcaaaaaggacgc
tatcgtcaatttaatcaatttggtgtagaagctattggtgctgaaaatcctagcgtagat
gcagaagtattagctatggttatgcatatttatcaatcatttggattaaaacatttaaag
cttgttattaatagtgtaggggatatggcgtctcgaaaagaatataacgaagcgttagtg
aaacactttgaaccagtaattcatgaattttgttcagattgtcaatcacgtttgcataca
aatccgatgcgaattttggattgtaaagtagaccgtgataaagaagcgattaagactgca
cctagaatcactgatttcttaaatgaggaatctaaggcatattatgaacaagtaaaagct
tatttagatgatttaggtattccatatattgaagatcctaacttagttcgtggattggat
tattatacacatacagcatttgaattaatgatggataaccctaactatgatggtgccatt
acaacgctttgtggtggtggccgttataatggtttattagaattgctagatggtccaagt
gaaacaggtattggttttgcgctaagtatagaacgattattgcttgcacttgaagaagaa
ggtatcgaattagatattgaagaaaacttagatttattcattgttacaatgggtgatcaa
gcagatcgatatgctgtgaagctattaaatcatttgagacataatggtattaaagcagat
aaagactatttacagcgtaaaattaaaggacaaatgaaacaagcagaccgtttaggtgcc
aagtttacaatcgttattggtgatcaagaattagaaaataataaaatcgatgttaaaaat
atgacaactggtgaatctgaaacaattgaattagacgcattagtcgaatattttaagaag
tag

DBGET integrated database retrieval system