KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01623Help
Entry
SAA6008_01623     CDS       T01886                                 

Gene name
ermA_1
Definition
(GenBank) rRNA adenine N-6-methyltransferase, ErmA
  KO
K00561  
23S rRNA (adenine-N6)-dimethyltransferase [EC:2.1.1.184]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Enzymes [BR:suk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.184  23S rRNA (adenine2085-N6)-dimethyltransferase
     SAA6008_01623 (ermA_1)
Ribosome biogenesis [BR:suk03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    SAA6008_01623 (ermA_1)
Antimicrobial resistance genes [BR:suk01504]
 Gene variants
  Macrolide resistance genes
   23S rRNA methyltransferases
    SAA6008_01623 (ermA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1733079..1733810
Genome map
AA seq 243 aa AA seqDB search
MNQKNPKDTQNFITSKKHVKEILNHTNISKQDNVIEIGSGKGHFTKELVKMSRSVIAIEI
DGGLCQVTKEAVNPSENIKVIQTDILKFSFPKHINYKIYGNIPYNISTDIVKRITFESQA
KYSYLIVEKGFAKRLQNLQRALGLLLMVEMDIKMLKKVPPLYFHPKPSVDSVLIVLERHQ
PLISKKDYKKYRSFVYKWVNREYRVLFTKNQFRQALKHANVTNINKLSKEQFLSIFNSYK
LFH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaaaaaccctaaagacacgcaaaattttattacttctaaaaagcatgtaaaa
gaaatattgaatcacacgaatatcagtaaacaagacaacgtaatagaaatcggatcagga
aaaggacattttaccaaagagctagtcaaaatgagtcgatcagttattgctatagaaatt
gatggaggcttatgtcaagtgactaaagaagcggtaaacccctctgagaatataaaagtg
attcaaacggatattctaaaattttccttcccaaaacatataaactataagatatatggt
aatattccttataacatcagtacggatattgtcaaaagaattacctttgaaagtcaggct
aaatatagctatcttatcgttgagaagggatttgcgaaaagattgcaaaatctgcaacga
gctttgggtttactattaatggtggagatggatataaaaatgctcaaaaaagtaccacca
ctatattttcatcctaagccaagtgtagactctgtattgattgttcttgaacgacatcaa
ccattgatttcaaagaaggactacaaaaagtatcgatcttttgtttataagtgggtaaac
cgtgaatatcgtgttcttttcactaaaaaccaattccgacaggctttgaagcatgcaaat
gtcactaatattaataaactatcgaaggaacaatttctttctattttcaatagttacaaa
ttgtttcactaa

DBGET integrated database retrieval system