KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01628Help
Entry
SAA6008_01628     CDS       T01886                                 

Definition
(GenBank) putative DNA repair protein, RadC
  KO
K03630  
DNA repair protein RadC
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1738346..1738900)
Genome map
AA seq 184 aa AA seqDB search
MKIKEMVTSEMPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNEL
KKSSINDLIKVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDL
TQEHFVILLLNSKNVVIKETCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDV
LTIV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattaaagaaatggtaacttcagaaatgccaagagaacgtttgttaagccatggt
gcaaaaagtctttcgaatacagaattattagctatattaattaacaccggaagaaaagga
ttctcgagcatagacattagtaatgaactgcttaaatctgcttcgaatctgaatgaattg
aaaaaatcttcaattaacgatttgataaaagttaaagggattggattacaaaaagcaatt
actttaaaagcagcatttgagttaggggaaaggatggggagaagagctgaaaataatcgt
ataaaaataacgcaaccaagtgatgttgctgattatatgattccaacaatgaaagattta
acacaagaacattttgtcattttattgttaaattcaaaaaatgtagtgattaaagaaacc
tgtgtttttaaaggtacattaaatagttcgattgtacatccacgtgaaatttttagtatt
gcggtgagagaaaatgccaatgcaatcatcgcagttcataatcatccatccggtgatgta
ttaaccatagtataa

DBGET integrated database retrieval system