KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01629Help
Entry
SAA6008_01629     CDS       T01886                                 

Definition
(GenBank) Type 4 prepilin-like proteins leader peptide-processing enzyme
  KO
K02236  
leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Module
Competence-related DNA transformation transporter
Brite
Enzymes [BR:suk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SAA6008_01629
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     SAA6008_01629
Secretion system [BR:suk02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   SAA6008_01629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1738897..1739604)
Genome map
AA seq 235 aa AA seqDB search
MVVLLSYSCSCIFSFLYQFISIEETSFDYLHRRSKCDYCNSSLKWYELMPIISFLLLKGR
CRNCRKRISLTHFLGETFALIPIVFIKYDFTYVNATLFITTYVFLLIFTMTDITSLMLDC
RLIIIYCIVSLSLSMIYPVAFIIISMTTHIFYFLFRAYIGYGDVLLISALSLFFPLQFTI
YVILFTFVIAGLVALITMIFKPIKLLPLVPFIFISFFINSLFYNDIHQFLGGVYF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttggtagtattgttatcttatagttgcagttgtatttttagttttctatatcaatttata
tctatagaagaaacgtcatttgattatttacatagaagatcgaaatgtgattattgtaat
tcgtcactcaaatggtatgaattaatgccgattattagttttttattattaaaagggcga
tgtcgaaactgtcgaaagcgtatttccctaacacatttcttaggggaaacctttgcttta
atacctatcgtctttattaagtatgatttcacatacgtaaatgctacgctatttataact
acatatgtttttctgcttatttttactatgaccgatatcacttctttaatgttagattgt
cgcttaattataatttattgtatcgtttctctctcgttaagtatgatttatccagtagct
tttatcattattagtatgaccacgcatatattctactttttatttcgggcatatattggt
tatggtgacgttttactaatatctgcactttctttgtttttccctctccaattcactatt
tatgtcattttatttacatttgtcattgctggtttagttgctttaattaccatgatattt
aagccgattaaactattaccccttgttccatttatatttatttccttttttatcaattca
cttttttataatgatatccatcaatttttaggaggcgtatatttttga

DBGET integrated database retrieval system