KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01632Help
Entry
SAA6008_01632     CDS       T01886                                 

Gene name
tag
Definition
(GenBank) DNA-3-methyladenine glycosylase I
  KO
K01246  
DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:suk00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SAA6008_01632 (tag)
Enzymes [BR:suk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     SAA6008_01632 (tag)
DNA repair and recombination proteins [BR:suk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAA6008_01632 (tag)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
1744191..1744751
Genome map
AA seq 186 aa AA seqDB search
MNECAFGTKDPVYLDYHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEAYEEAF
YDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYV
NGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLQDCP
SKPKHN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatgcgcatttggtactaaagatccagtctacttagactatcatgatcatgta
tggggacaaccgctctatgatagcaaggcattgtttaaacttttagcattagaatcacaa
catgctgggctatcttggttaactattttaaaaaagaaagaagcctatgaagaagcattt
tatgatttcgaaccagaaaaggtagcacaaatgaccgctcaagatatcgaccgcttaatg
acttttccaaatatcgttcatcatcgtaaaaaattagaagcaattgttaatcaagctcaa
gggtatttaaaaattgaacaagcatatggtagttttagtaaatttttatggtcatatgta
aatggtaagcctaaagatttgcagtatgaacatgcttctgatcgtatcacagttgatgat
actgcaacacaactatctaaagatttaaaacaatacgggtttaaatttttaggtccagta
acagtattttcgtttttagaagcagccggtttatatgatgcacatttacaagattgtcca
tcaaagcctaaacataattaa

DBGET integrated database retrieval system