KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01635Help
Entry
SAA6008_01635     CDS       T01886                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  
glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAA6008_01635 (hemL)
Enzymes [BR:suk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SAA6008_01635 (hemL)
Amino acid related enzymes [BR:suk01007]
 Aminotransferase (transaminase)
  Class III
   SAA6008_01635 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1746243..1747529)
Genome map
AA seq 428 aa AA seqDB search
MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLS
WGPLILGHRDPQVISHLHEAIDKGTSFGASTLLENKLAQLVIDRVPSIEKVRMVSSGTEA
TLDTLRLARGYTGRNKIVKFEGCYHGHSDSLLIKAGSGVATLGLPDSPGVPEGIAKNTIT
VPYNDLDALKIAFEKFGNDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDE
VMTGFRVGYHCAQGYFGVTPDLTCLGKVIGGGLPVGAFGGKKEIMDHIAPLGNIYQAGTL
SGNPLAMTSGYETLSQLTPETYEYFNMLGDILEDGLKRVFAKHNVPITVNRAGSMIGYFL
NEGPVTNFEQANKSDLKLFAEMYREMAKEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFD
TALSRIVK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagatatacgaaatcagaagaagcaatgaaggttgctgaaactttaatgcctggtggt
gtaaatagtccagtacgcgcatttaaatcagtagatacaccagcaatttttatggatcac
ggtaaaggttcaaaaatttatgatatcgatggtaacgagtatatcgactatgtactaagt
tggggaccacttattttaggacatagagaccctcaagttattagtcatttacatgaagca
attgataaaggtacaagttttggtgcatcaacattacttgaaaataaattggcgcagctc
gttattgaccgagtaccttcaatagaaaaagtgcgtatggtgtcatctggtacagaagct
acattggatactttaagattagcacgtggttatactggcagaaataaaattgtgaaattt
gaaggttgctatcatggtcatagtgattcgttattaatcaaagctggttctggggtggca
acattaggattgccggattctcctggtgtgcctgaaggtattgctaaaaatacaattaca
gttccatacaatgatttagatgcacttaaaatcgctttcgaaaaatttggaaacgatatt
gctggtgtaatcgtagaacctgttgctggtaatatgggtgtcgtaccgccgattgaaggt
tttttacagggattaagagatattacgactgaatacggcgcattgctaattttcgatgaa
gtaatgactggtttcagagtcggttatcattgtgcacaaggttactttggtgtgacacca
gatttaacttgcttaggaaaagttatcggtggaggactacctgtaggtgcatttggtggt
aaaaaagaaatcatggatcatatagcaccattaggaaatatttatcaagcgggtacgtta
tcaggaaatcctcttgcaatgacaagtggttatgaaacgttaagccaattaacgccagag
acatatgagtattttaatatgttaggcgatatacttgaagacggtttaaaacgtgtattt
gctaaacacaatgtaccaataactgtaaatagagcaggttcaatgattggttatttctta
aatgaaggacctgtaactaattttgaacaagcgaataaaagtgatttgaaattatttgca
gaaatgtatcgagaaatggcaaaagaaggtgtgtttttaccaccatctcaatttgaaggt
acattcttatctacggcacacacgaaagaagatattgaaaaaacgattcaagcatttgat
acggctttaagtcgtattgtaaaataa

DBGET integrated database retrieval system