KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01638Help
Entry
SAA6008_01638     CDS       T01886                                 

Gene name
hemC
Definition
(GenBank) hydroxymethylbilane synthase
  KO
K01749  
hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAA6008_01638 (hemC)
Enzymes [BR:suk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     SAA6008_01638 (hemC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1749244..1750170)
Genome map
AA seq 308 aa AA seqDB search
MRKLVVGSRRSKLALTQSQQFIDKLKAVEPNLEIEIKEIVTKGDRIVDKQLSKVGGKGLF
VKEIQHELFEKNIDMAIHSLKDVPSVIPEGLTLGCIPDRELPFDAYISKTHTPLSQLPEG
SIIGTSSLRRGAQILSKYPNLEIKWIRGNIDTRLEKLQTEDYDAIILAAAGLRRMGWSDD
IVTSYLDRDTLLPAIGQGALGIECRSDDEELLTLLSKVHNDEVAKCVTAERTFLAEMDGS
CQVPIAGYATISDQNEIEFTGLIMTPDGKERFEYTMNGTDPVELGKTVSNKLKEQGAYEI
IKRLNEQH
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaattagtcgttggctccagaagaagtaaattagctttaacacaaagccagcaa
tttattgataaattaaaagctgtcgagccaaatctagaaattgaaattaaagaaattgtc
acgaaaggcgatcgtatagtagataaacaattgtctaaagtcggaggcaaaggcttattt
gttaaagaaatacaacatgaactttttgaaaaaaatatcgatatggcaatacactcgctt
aaagacgtaccaagtgtaattccggaaggtttaacattaggttgtatccctgatagagaa
ttaccttttgatgcgtatatttctaaaacacatacaccactatcccaattgccagaaggc
agtattattggtactagttcattacgtcgtggtgcacaaatattatctaagtatcctaat
ttagagattaaatggattagaggtaatatagatacacgattagaaaagttacaaactgaa
gattatgatgcgattattttagctgcagctggtttaagaagaatgggctggtcagatgat
attgtaacatcttatcttgatagagatacattgttacctgcaatcggacaaggtgcttta
gggatagaatgtcgtagtgacgatgaagaactattaacattattaagcaaagtacataat
gatgaggttgcaaaatgtgtgactgctgaacgaacgtttttagcagaaatggatggtagt
tgtcaggtgccaattgcaggatatgctacaatctcagatcaaaacgaaatcgaatttaca
ggtttaattatgaccccagatggtaaagaacgatttgaatatacaatgaacggaacagat
ccggttgagttaggcaaaacagtgagtaacaaattaaaagagcaaggtgcttatgaaatt
ataaaacgcttaaatgaacaacattaa

DBGET integrated database retrieval system