KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01640Help
Entry
SAA6008_01640     CDS       T01886                                 

Gene name
hemA
Definition
(GenBank) glutamyl-tRNA reductase
  KO
K02492  
glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAA6008_01640 (hemA)
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     SAA6008_01640 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1751049..1752395)
Genome map
AA seq 448 aa AA seqDB search
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVD
QIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQ
IRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKL
KSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLL
ESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDV
DDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETM
DSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIE
AECPHEQAKQQKESKVKEISARRIFSFE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcattttattgcaattagtataaatcatcgcacagctgatgttgcactaagagagcaa
gttgcttttagagatgatgccttacgaattgcccatgaagatttatatgaaactaaatct
attttagaaaatgtcatattatcaacatgtaatcgaactgaagtatatgctgttgttgat
caaattcacacaggtcgttactatattcaacgatttctagctcgtgcatttggatttgaa
gtagatgatattaaagcaatgtcagaagtaaaagtgggggacgaagcagtagaacattta
ttgcgtgtcacttctggtttagattcaatcgtacttggagaaactcaaattttaggtcaa
ataagagatgcatttttcttagcgcaaagcacaggtacgacaggaacaatttttaatcat
ctatttaaacaggcaattacttttgcaaaaagagcacataatgaaacagatatagctgat
aatgctgtaagtgtgtcttatgctgcggtcgagttggcgaaaaaagtatttggcaaattg
aaaagtaagcaagctatcattattggtgcaggggaaatgagtgaattatcactattaaat
cttcttggttctggaattactgatattacagtagtaaatagaacaattgaaaatgctatg
aaattagcagcaaagcatcaagtgaaatatgatgaactatcatcattaccaaatttactt
gaaagtgcagatattgtgattagttcaacgagtgcacaatcttatatcattacaaatgaa
atgatagaaagaattgcagaaaatagaaagcaagattcactagtattgattgatattgca
gttcctcgagatattgaacctggtattagtgccatcacaaacatctttaattatgatgtt
gatgacttaaaaggtttagttgatgcaaacttacgtgagcgacaattagcggctgcaaca
atttcggaacaaattcctgcagaaatacatgcacacaatgagtggattagtatgttgggt
gttgttccagtgattagagctttacgtgaaaaagctatggcaattcaagcagaaacgatg
gacagtattgatcgtaaattgccagggttaagcgaaagagaacgtaaaattatatctaaa
catacaaaaagtatcatcaatcaaatgttgaaagatcctattaaacaggccaaagaatta
agtagtgataagaaaagtaatgaaaaattagagctatttcaaaatatatttgatatcgaa
gctgaatgtcctcatgagcaagcgaagcaacaaaaagaaagcaaggtcaaggaaatttca
gcgcgacgtatctttagttttgaataa

DBGET integrated database retrieval system