KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01641Help
Entry
SAA6008_01641     CDS       T01886                                 

Gene name
engB
Definition
(GenBank) ribosome biogenesis GTP-binding protein YsxC
  KO
K03978  
GTP-binding protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Chromosome [BR:suk03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SAA6008_01641 (engB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1752612..1753202)
Genome map
AA seq 196 aa AA seqDB search
MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
TQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHD
PTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQ
NNKQQQIWNLIEPYIS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaatcctaataatatagaattaatcattagtgcagtaaaagaagaacaatat
ccagaaacagaattgtctgaagttgcactgagcggtcgatctaatgtaggtaagtctaca
tttatcaatagtatgattggcagaaaaaatatggcacgtacatcacagcaacccggcaaa
acgcaaacgttaaatttttataatatagatgaacaacttatttttgtggatgttccaggg
tatggatatgctaaagtaagtaaaacacaacgtgaaaaatttgggaaaatgattgaggaa
tatataactaagagagagaatttgcaattagttattcaattagttgatttaagacatgat
ccaacacaagatgatatcttaatgtacaattatttgaaacattttgatattcctacttta
gttatatgcactaaagaagacaaaattccaaaaggtaaggttcaaaagcatattaaaaat
attaagacacaattagatatggacccagacgatacaattgtaagttattcatcaattcaa
aataataaacaacaacaaatatggaatttaattgaaccgtatatttcatag

DBGET integrated database retrieval system