KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01642Help
Entry
SAA6008_01642     CDS       T01886                                 

Gene name
clpX
Definition
(GenBank) ATP-dependent Clp protease, ATP-binding subunit ClpX
  KO
K03544  
ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
Chaperones and folding catalysts [BR:suk03110]
 Heat shock proteins
  HSP100
   SAA6008_01642 (clpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1753356..1754618)
Genome map
AA seq 420 aa AA seqDB search
MFKFNEDEENLKCSFCGKDQDQVKKLVAGSGVYICNECIELCSEIVEEELAQNTSEAMTE
LPTPKEIMDHLNEYVIGQEKAKKSLAVAVYNHYKRIQQLGPKEDDVELQKSNIALIGPTG
SGKTLLAQTLAKTLNVPFAIADATSLTEAGYVGDDVENILLRLIQAADFDIDKAEKGIIY
VDEIDKIARKSENTSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPNQEMIQIDTTN
ILFILGGAFDGIEEVIKRRLGEKVIGFSSNEADKYDEQALLAQIRPEDLQAYGLIPEFIG
RVPIVANLETLDVTALKNILTQPKNALVKQYTKMLELDDVDLEFTEEALSAISEKAIERK
TGARGLRSIIEESLIDIMFDVPSNENVTKVVITAQTINEETEPELYDAEGNLINNSKTSA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattcaatgaagatgaagaaaatttgaaatgctctttctgcggaaaagaccaa
gatcaagtaaaaaaacttgtagcaggaagtggtgtatatatttgtaatgagtgtattgaa
ttatgctcagaaatcgtcgaagaagaattagctcaaaacacttctgaagcgatgacagaa
ttacctactcctaaagaaattatggatcatttaaacgaatatgttattggtcaagaaaaa
gctaaaaaatctttagctgtagctgtttataaccactataagcgtattcaacaattagga
ccaaaagaagatgatgttgaattacaaaaaagtaacattgcattaattgggccaacaggt
agtggtaaaacattattagctcaaaccttagccaagacgttgaatgtaccatttgcaatt
gcagatgcgacaagtttaactgaagctggttatgtaggcgatgatgttgaaaatatcttg
ttgagattaattcaagcagctgactttgacattgataaagccgaaaaaggtattatttat
gtagatgaaattgataaaattgcacgtaaatctgaaaacacatctataacacgtgacgtt
tcaggtgaaggtgttcaacaagcattgcttaaaatcttagaaggtacgactgcaagtgtt
ccgccacaaggtggacgcaaacatccaaaccaagaaatgattcaaattgatacaacaaat
atcttatttattcttggtggtgcctttgatggtattgaagaagtgattaagcgccgtctt
ggtgaaaaagttattggtttctcaagcaatgaagctgataaatatgacgaacaagcatta
ttagcacaaattcgcccagaagatttgcaagcctatggtttgattcctgaatttatcgga
cgtgtgccaattgtagctaatttagaaacattagatgtaactgcgttgaaaaacatctta
acgcaacctaaaaatgcacttgtgaaacaatatactaaaatgctggaattagatgatgtg
gatttagagttcactgaagaagctttatcagcaattagtgaaaaagcaattgaaagaaaa
acaggtgcgcgtggtttacgttcaatcatagaagaatcgttaatcgatattatgtttgat
gtgccttctaacgaaaatgtaacgaaggtagttattacagcacaaacaattaatgaagaa
actgaaccagaactatacgacgcagaaggcaatttaattaataatagtaaaacatcagct
taa

DBGET integrated database retrieval system