KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01647Help
Entry
SAA6008_01647     CDS       T01886                                 

Gene name
rpmI
Definition
(GenBank) 50S ribosomal protein L35
  KO
K02916  
large subunit ribosomal protein L35
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:suk00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SAA6008_01647 (rpmI)
Ribosome [BR:suk03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAA6008_01647 (rpmI)
  Bacteria
    SAA6008_01647 (rpmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1758343..1758543)
Genome map
AA seq 66 aa AA seqDB search
MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQ
LLAYKK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaatgaaaactcaccgcggagcagctaaacgtgttaaaagaactgcttcaggt
caattaaaacgttcaagagctttcacatctcacttattcgcaaacaagagcactaaacaa
aaacgtcaattacgtaaagctagattagtgtctaagagcgatatgaaacgtgtaaaacaa
ttattagcatacaaaaaataa

DBGET integrated database retrieval system