KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01655Help
Entry
SAA6008_01655     CDS       T01886                                 

Gene name
coaE
Definition
(GenBank) putative dephospho-CoA kinase
  KO
K00859  
dephospho-CoA kinase [EC:2.7.1.24]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAA6008_01655 (coaE)
Enzymes [BR:suk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     SAA6008_01655 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1767793..1768416)
Genome map
AA seq 207 aa AA seqDB search
MPKVIGLTGGIASGKSTVSELLSVFGFKVVDADKAAREAVKKGSKGLAQVREVFGDEAID
ENGEMNRRYMGDLVFNHPEKRLELNAIIHPIVRDIMEEEKQEYLKQGYNVIMDIPLLFEN
ELENTVDEVWVVYTSESIQMDRLMQRNNLSLEDAKARVYSQISIDKKSRMADHVIDNLGD
KLELKQNLERLLEEEGYIEKPNYGEED
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagttattggtctaacaggtggaatcgcctcaggaaaatcaacagtatcagaa
ctcttatccgtattcggttttaaagtagtagatgctgataaagcagccagggaagctgtt
aaaaaggggagtaaaggtttagctcaagtacgagaagtctttggtgatgaagcaattgat
gaaaatggtgagatgaatcgtcgttatatgggtgatctagtgtttaatcatccagaaaaa
cgcttagaattaaatgctatcatacatcctatcgtgcgagatattatggaagaagaaaag
caagaatatttaaaacaaggatataatgtaatcatggatattccattattatttgaaaat
gaattggaaaatacagtagacgaagtgtgggttgtatacacttctgaaagtatacaaatg
gatcgtttaatgcaacgtaataatttgtcattagaagatgcgaaagcacgtgtctatagc
caaatttctattgataaaaaaagccgaatggccgatcatgttatcgataatttaggggat
aaacttgaattaaaacaaaaccttgagagattgttagaagaagaaggttatattgaaaag
ccgaattacggagaagaagattaa

DBGET integrated database retrieval system