KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01703Help
Entry
SAA6008_01703     CDS       T01886                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00010  Glycolysis / Gluconeogenesis
suk00620  Pyruvate metabolism
suk00640  Propanoate metabolism
suk00680  Methane metabolism
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01120  Microbial metabolism in diverse environments
suk01130  Biosynthesis of antibiotics
suk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6008_01703 (acsA)
   00620 Pyruvate metabolism
    SAA6008_01703 (acsA)
   00640 Propanoate metabolism
    SAA6008_01703 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SAA6008_01703 (acsA)
Enzymes [BR:suk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAA6008_01703 (acsA)
Lipid biosynthesis proteins [BR:suk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAA6008_01703 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADL65735
Position
complement(1828037..1829743)
Genome map
AA seq 568 aa AA seqDB search
MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRIFVKEGLSAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTME
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgaagtttataaaggagcgcaaggtaaacataaccttaaagattatgaagaa
acatataatacttttgattggaaagacgtagaacaagcattttcttggagtgaaactgga
aaaatgaacatggcatatgaatgcatagatcgccatgtagatcaaggattaggggataaa
atagcgttaaattacaaagatgagcacagaaaagaatcgtatacttataaagatatgcaa
cggttatctaataaagcagcgaatgttttgtctgaacatgcagaagttgacaaaggtgac
agagtatttatatttatgtcgcgtacacctgaactatattttgcgttgttaggtgtttta
aaaattggtgcaattgttgggccgttatttgaagcatttatggaaaaggcagttgcggat
agattagagaacagtgaagctaaagtgttaattactaataaggcattgttacctcgagta
cctgtagataaattaccaaacttgaaaaaaattgttgtcgtagatgaggatgtagaagac
aattacatagacttcattagtttgatggaaactgctagcgatgaatttgacattgaatgg
ttaaagtcggatgatggtttgattttacattatacatcaggttctactgggcaacctaaa
ggtgtattgcatgttcaacaagcaatgttagtgcactatatttctggaaaatatgtatta
gatttacaagaagatgatgtttattggtgtacagcagatccaggttgggttacaggaaca
tcttatggtatttttgcaccatggttaaatggcgctacaaattgtatagctggtggtcgc
ttttcgccagaacagtggtatagtatgattgaagattttaaagtgacgatttggtatacg
gcaccaacagctttaagaatgttaatgagtgctggtgacgatattgttgagaaatatgac
ttgtcatcgttacgttcgattctatcagtaggtgagcctttaaatcctgaagttataaaa
tgggcgaaaaaagtatacggtttaacggtgttagatacttggtggatgacagaaacaggt
ggacatatgattgttaactatccaacgatggacgtcaagcttggctcaatgggcaaacca
ttacctggtattcaagctgcaattatcgatgatgcagggaatgaattaccaccaaatcga
atgggcaaccttgctataaaaaaaggctggccatcaatgatgtatcgtatctggaagaat
ccagaaaaatataaatcatattttattggagactggtatgtatctggtgattcggcatat
aaagatgaagatggttacttctggttccaaggacgtgttgatgatgtaattatgacagct
ggtgaacgagttggaccatttgaggttgagtctaaattggttgaacacgaagcagttgcc
gaagcaggaattattggtaaacctgatccggttcgcggtgaaataattaaggcgtttgtt
gcactgagaaaaggatatgaaccaacagacgaattaaaagaagaaattcgtatatttgtt
aaagaaggtttgtcggcacatgcagcaccacgtgaaatcgaatttaaagataaattacct
aaaacacggtcaggtaaaattatgagacgtgtattaaaagcttgggaattaaatttagat
gctggggatttaagtacaatggaataa

DBGET integrated database retrieval system