KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01789Help
Entry
SAA6008_01789     CDS       T01886                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAA6008_01789 (hemY)
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SAA6008_01789 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1921515..1922903)
Genome map
AA seq 462 aa AA seqDB search
MAIIGAGITGLSSAYFLKQQDPNIDVTIFEASNRPGGKIQSYRKDGYMIELGPESYLGRK
TIMTELAKDIGLEQDIVTNTTGQSYIFAKNKLYPIPGGSIMGIPTDIKPFVTTKLISPLG
KLRAGFDLLKKPTQMQDGDISVGAFFRARLGNEVLENLIEPLMGGIYGTDIDKLSLMSTF
PNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLSSFIEALEQDVKNK
GVTIRYNTSVDDIITSQKQYKIVYNDQLEEVYDGVLVTTPHQVFLNWFGQDPAFDYFKTM
DSTTVATVVLAFDEKDIENTHDGTGFVIARTSDTDITACTWTSKKWPFTTPEGKVLIRAY
VGKPGDTVVDDHTDNELVSIVRRDLSQMMTFKGDPEFTIVNRLPKSMPQYHVGHIQQIRQ
IQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtggctattataggagcggggataacaggtttatcaagtgcatattttttaaaacagcaa
gatcctaatattgatgtaaccatctttgaagcatcgaatcgtccggggggaaagattcaa
tcgtatcgtaaagatggttatatgattgaactagggcctgaatcttatttaggtagaaaa
acgattatgacagaattagcgaaagatattggattagaacaagatattgttacaaatacg
actggacaatcatatatttttgcgaaaaataaattatatccgattccaggtggttcaatt
atgggtattccaacagatattaaaccatttgttactacaaaattaatatcgccacttggt
aaattaagagcagggtttgatttattaaaaaaacctactcaaatgcaggatggtgacatt
tctgttggtgcatttttcagagcaagattaggtaatgaggtacttgagaatttaatagag
cctttaatgggtggtatttatggtaccgatattgataaattaagtttgatgagtacgttt
cctaattttaaagaaaaagaagaggcattcggaagtctgataaaaggtatgaaggatgag
aaaaataagcgtctgaaacaaagacaattatatcctggcgcaccgaaaggacaattcaaa
caatttaagcatggtttaagctcatttattgaagcattagaacaagatgttaaaaataaa
ggtgtgacaatacgctacaatacgtcagtggatgatataattacatctcaaaaacaatat
aaaattgtttacaatgatcaactagaagaagtgtatgatggcgtattagtaacgacacca
catcaagtgtttttaaattggttcggacaagatccagcatttgattactttaaaacgatg
gatagtacgactgttgcaactgttgtattggcatttgatgaaaaagacattgaaaatacc
catgatggtactggcttcgtaattgcgagaacgagtgatacagacattaccgcatgtact
tggacatcgaaaaaatggccatttactacaccggaaggtaaggttttgattcgtgcgtat
gtaggtaaaccaggtgatactgtggttgatgatcatacagataatgaattagtatcgatt
gtacgtagagatttaagtcaaatgatgacatttaaaggtgatcctgaatttacaattgtc
aatcgtttgccgaaaagtatgccacagtaccatgtcggtcatattcaacaaattagacag
attcaagcacatattaaacaaacatatccacgacttagagtaactggtgcatcttttgaa
gcggttggactacctgattgtattacgcaaggtaaagttgctgctgaagaagtaatcgca
gagttgtaa

DBGET integrated database retrieval system