KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01970Help
Entry
SAA6008_01970     CDS       T01886                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:suk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:suk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2093303..2093788)
Genome map
AA seq 161 aa AA seqDB search
MTLSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFNSIGKPLPNRRN
VVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLYEAMIDQVDDMYITVIDGKFQG
DTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRKGK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcaataattgtcgctcacgataaacaaagagtcattgggtaccaaaatcaa
ttaccttggcacttaccaaatgatttaaagcatattaaacaactgaccactgggaataca
cttgtaatggcacggaaaacttttaattctatagggaagccattgccaaatagacgtaac
gtcgtactcactaaccaagcttcatttcaccatgaaggggtagatgttataaactctctt
gatgaaattaaagagttatctggtcatgtttttatatttggaggacaaacgttatacgaa
gcaatgattgaccaggtagatgatatgtatatcacagtaatagatggaaagtttcaagga
gacacattctttccaccatacacattcgaaaactgggaagtcgaatcttcagtagaaggt
caactagatgaaaaaaatactataccgcatacattcttacatttagtgcgtagaaaaggg
aaatag

DBGET integrated database retrieval system