KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_02060Help
Entry
SAA6008_02060     CDS       T01886                                 

Gene name
argE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00300  Lysine biosynthesis
suk01100  Metabolic pathways
suk01120  Microbial metabolism in diverse environments
suk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAA6008_02060 (argE)
Enzymes [BR:suk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAA6008_02060 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADL66080
Position
2161615..2162838
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLTDLFDKYDIKSEILKVNEHRANIVAEI
GNGSPILALSGHMDVVDAGNQDNWSYPPFQLTEKDGKLYGRGTTDMKGGLMALVVSLIEL
KEQNELPHGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLIIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNLFKEKYSELKQQDTKHELDVAPMFKSLIGK
EISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIIND
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQDEIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIQYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaacagatttattcgacaagtac
gatattaaatctgaaattttgaaagttaatgaacaccgcgccaatatcgttgcagaaatc
ggtaacggctcacctatactcgcattgagtggtcatatggatgttgttgatgcaggaaat
caagataattggtcatatcccccttttcaactgacagaaaaagatggcaaattatatggc
cgaggcactacagatatgaaaggcggtttaatggctttggtcgtatctctaatcgaatta
aaagaacaaaatgaattgcctcatggaacgattagattactggctactgctggcgaagag
aaagaacaagaaggtgccaaattattagctgataaaggctatttagacgatgtcgatggc
ttaattattgctgaaccaactggatctggaatttattatgcacataaggggtctatgtca
tgtaaagtaactgcaactggtaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatctatttaaagaaaaatattcagagcttaaa
caacaagatactaaacatgaattagatgttgcgcctatgttcaaatcattgattggaaaa
gaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaatgat
gtggatagcaataagctttcactcgatattccaagcaatcaccgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagaacaagac
gaaatatttgtttcagcgcttgtaggtgcaacagatgcctctagtttcttaggagataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatatttttaaagaggcttcc
attcaatatttaaaagaaaaataa

DBGET integrated database retrieval system