KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_02138Help
Entry
SAA6008_02138     CDS       T01886                                 

Gene name
murA
Definition
putative UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:suk00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:suk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2248669..2249934)
Genome map
AA seq 421 aa AA seqDB search
MDKIVIKGGNKLTGEVKVEGAKNAVLPILTASLLASDKPSKLVNVPALSDVETINNVLTT
LNADVTYKKDENAVVVDATKTLNEEAPYEYVSKMRASILVMGPLLARLGHAIVALPGGCA
IGSRPIEQHIKGFEALGAEIHLENGNIYANAKDGLKGTSIHLDFPSVGATQNIIMAASLA
KGKTLIENAAKEPEIVDLANYINEMGGRITGAGTDTITINGVESLHGVEHAIIPDRIEAG
TLLIAGAITRGDIFVRDAIKEHMASLVYKLEEMGVELDYQEDGIRVRAEGELQPVDIKTL
PHPGFPTDMQSQMMALLLTANGHKVVTETVFENRFMHVAEFKRMNANINVEGRSAKLEGK
SQLQGAQVKATDLRAAAALILAGLVADGKTSVTELTHLDRGYVDLHGKLKQLGADIERIN
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatagtaatcaaaggtggaaataaattaacgggtgaagttaaagtagaaggt
gctaaaaatgcagtattaccaatattgacagcatctttattagcttctgataaaccgagc
aaattagttaatgttccagctttaagtgatgtagaaacaataaataatgtattaacaact
ttaaatgctgacgttacatacaaaaaggacgaaaatgctgttgtcgttgatgcaacaaag
actctaaatgaagaggcaccatatgaatatgttagtaaaatgcgtgcaagtattttagtt
atgggacctcttttagcaagactaggacatgctattgttgcattgcctggtggttgtgca
attggaagtagaccgattgagcaacacattaaaggttttgaagctttaggcgcagaaatt
catcttgaaaatggtaatatttatgctaatgctaaagatggattaaaaggtacatcaatt
catttagattttccaagtgtaggagcaacacaaaatattattatggcagcatcattagct
aagggtaagactttaattgaaaatgcagctaaagaacctgaaattgtcgatttagcaaac
tacattaatgaaatgggtggtagaattactggtgctggtacagacacaattacaatcaat
ggtgtagaatcattacatggtgtagaacatgctatcattccagatagaattgaagcaggc
acattactaatcgctggtgctataacgcgtggtgatatttttgtacgtgatgcaatcaaa
gaacatatggcgagtttagtctataaactagaagaaatgggcgttgaattggactatcaa
gaagatggtattcgtgtacgtgctgaaggggaattacaacctgtagacatcaaaactcta
ccacatcctggattcccgactgatatgcaatcacaaatgatggcattgttattaacggca
aatggtcataaagtcgtaaccgaaactgtttttgaaaaccgttttatgcatgttgcagag
ttcaaacgtatgaatgctaatatcaatgtagaaggtcgtagtgctaaacttgaaggtaaa
agtcaattgcaaggtgcacaagttaaagcgactgatttaagagcagcagccgccttaatt
ttagctggattagttgctgatggtaaaacaagcgttactgaattaacgcacctagataga
ggctatgttgacttacacggtaaattgaagcaattaggtgcagacattgaacgtattaac
gattaa

DBGET integrated database retrieval system