KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_02666Help
Entry
SAA6008_02666     CDS       T01886                                 

Gene name
acsA2
Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:suk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:suk00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:suk00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:suk00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:suk00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2796161..2797759)
Genome map
AA seq 532 aa AA seqDB search
MQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNKVGNVLAS
HGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGEINAVIAL
EPFTVEFEKIKEYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDMAILSYTSG
TTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLSVLGSGAT
AFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAVSAGEPLN
REVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPGSSVTVVDDEGNSV
PANTKGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWFEGRRDDI
IISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGDDTLVKEL
QQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDAEIEKWQQQKDSNQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtcagctctattcgcgcctgaaaaatataacattatttcggaaatcgaaaaa
tatagccacataccagataaaaaggcaattttatatcataatactgaaggcgaagatata
tcagtcacttaccaacagctcattgaacagtctaataaagtaggtaatgttttagcatcg
cacggtttatctaaaggcgataaagtactcattatgatgccacgatctattgcgacatat
gaattatatattgctgctttaaaattaggtgttgcaatcattccatgttctgaaatgcta
agaactaaagatttacaataccgtatcacacacggtgaaataaatgctgttattgcacta
gagccattcacagttgaatttgaaaaaattaaagaatatgatgcgttaactaaatttgtt
attgccggtcaaaaagatggatggatttcacttgaagctgaaaaagaaaacgcaagtaac
aaactagaaatggcagatacgacgcgtgatgatatggcgattctgtcatatacatctggt
acaactggcaatcctaaagccgttacacattgtcatggatggggatttgcacatttacaa
atggcaccaaaacattggttatgtattaatgaagatgacttagtttgggcaacagcagca
ccaggttggcaaaaatgggtatggagtcctttcttatctgtattaggttcaggtgcaact
gcttttgtatttaatggaagattcagccctgagacatacttagaattgcttcaaaaatat
caaattaatgttttatgttgtacaccgacagaatatcgtatgatggctaaattacagaac
ttaaatgattatgacttaacgcatttacatagtgccgtttctgcaggtgagccactaaat
cgagaagtagttgaacaattcaagaaatactttaatttaactgtaagagatggatatggc
cagactgaaagtaccttgcttataggctttttaaaagatacaccacaaaggattggatca
atgggtaaaggcattccgggtagttcggtcactgtagtagatgatgaggggaatagcgta
cctgctaatacgaaagggaatattgcagtaccacttgatttgccagcacttttcaaagga
tattataaagagccagaacgtacggcgaaagcgcaaacaggtaaatactacatcactggt
gacttagctcatgtagatgatgatggttatttctggtttgaaggacgtcgagatgacatt
attattagttcaggctatacgattgggccttttgaagttgaagatgcgttaacgaatcat
ccagccgttaaagaatgtgctgtagtagcaaaacctcatgatatacgaggaaatattgtt
aaagcattcgttattttacaggaccatactgcgggtgatgatacgctagttaaagaacta
caacaatttgttaaaaatgaagttgcaccatataaatatccaagagagattgaattcgtt
gacgacttaccaaaaacaaactcaggtaaaattcgtcgtgttgaactacgagatgctgaa
atagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system