KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0165Help
Entry
SYO3AOP1_0165     CDS       T00715                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SYO3AOP1_0165
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYO3AOP1_0165
Enzymes [BR:sul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SYO3AOP1_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(181447..182739)
Genome map
AA seq 430 aa AA seqDB search
MLKEDVKLKEALIIEGGNKLEGVLEVSGAKNAALPNMAATILTSDEVIIENLPDLLDIDT
MKKLLQELGTEINHIKDKTYSFKLTNPKSYTAPYDLVNKMRASILVLGPMLARFGYAEVA
LPGGCSIGARPVDLHLKALEKMGAQIKIEHGYIKAYAPKGLKGAHIFFDKITVTGTENIL
MAASLAEGQTIIENAALEPEVVDLAVMLKKMGADIAGEGTNRIVINGVKELHGTYHKVIP
DRIEAGTFLVLAALTDGKIIIKNYPSQYLEYVEEISNKIGIHIVKLSDNEVLIKREEKLK
PVNIETKEYPLFPTDLQAQFMTLLCFADGISEITENIFENRFMHVPELNRLGADIEIKGK
TAIIRPVKKFTGAEVKATDLRASAAMVIAGLIAEGETKIFSIYHLDRGYEHIDDKLINIG
AKIRREIVEH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggaagatgttaagttgaaggaagcattaattatagaaggtggaaataaacta
gagggtgtattagaagtttctggagctaaaaatgccgcacttcctaacatggctgcaacc
atcctaacatctgatgaagtaataatagaaaaccttccagaccttttagatatagataca
atgaaaaagcttttacaagaattaggaacagaaataaatcacataaaagataaaacatac
agttttaaacttactaatccaaaatcttacaccgccccatacgatttagtaaataagatg
agggcatctatccttgtactgggtccaatgcttgcaaggtttggctatgcagaagttgct
ttgcccggtggatgttctatcggagcaagaccggttgatttacatctaaaagcattagaa
aaaatgggagcccagataaaaatagagcatgggtatataaaagcctatgcaccaaaaggc
ttaaagggagctcatattttctttgacaaaatcacagttacaggaacagaaaatatttta
atggctgcatctttagcagaaggtcagacaattatagaaaacgcagcattagagccggag
gttgtagatcttgccgttatgcttaaaaaaatgggagcagatattgcaggtgaagggact
aatagaattgttataaacggcgtaaaagaacttcacggaacctatcataaagtaattccg
gatagaattgaagccggaacttttttagtattagctgcactgacagatggaaaaataata
atcaaaaactatccaagtcaatatttagagtacgtggaagaaatttcaaataaaatcggc
atacacattgtaaagctttcagataacgaagttttaattaaaagagaagaaaaattaaaa
cctgtaaatatagagacaaaagaatatccactatttccaacagaccttcaagctcagttt
atgactctactttgttttgctgatggaatatctgagattacagaaaatatttttgaaaat
agatttatgcatgttccagagttaaacagacttggagcagatattgagataaaaggaaaa
actgccattattagacctgttaagaaatttacaggagcagaagtaaaagcaacagattta
agagcaagtgctgcaatggtaatcgctggcttgatagcagaaggagaaacaaaaatattt
agcatctatcatttagacagaggttatgaacatatagatgataaattaatcaacatcggt
gctaagataagaagggaaattgtggagcattaa

DBGET integrated database retrieval system