KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0238Help
Entry
SYO3AOP1_0238     CDS       T00715                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00900  Terpenoid backbone biosynthesis
sul01100  Metabolic pathways
sul01110  Biosynthesis of secondary metabolites
sul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYO3AOP1_0238
Enzymes [BR:sul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SYO3AOP1_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C tRNA_bind_2
Motif
Other DBs
NCBI-ProteinID: ACD65883
JGI: SYO3AOP10238
UniProt: B2V7G0
Position
255485..256312
Genome map
AA seq 275 aa AA seqDB search
MEILYSPAKINLGLWIVDKRPDGYHEIFTLYHTLDFYDRIIIQEHPFLEVKTSMPEIKQE
ENIVYKAISLFESYTGIEQNLQVIIEKNIPVGGGLGGGSSNAATVLNYLNKKHDNILPEE
KLFEIAVKLGADVPFFLKGGFAIGEGIGEKLTFLPKTLNEEIFIIYPNIKSDTKTVYSKV
DKSILTNKGDLNIILSLINEYDIKKLEAYIENKLGNIALDLYPEIKEAYDFLNYLGFSPK
VSGSGSCVYVIGRPTAEVEKAAAIKGWRLIKTKLK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaaatattatactcaccagctaaaataaacttaggtttatggatagtagataaaaga
ccggatggttatcatgaaatttttactctatatcatactcttgatttttatgacagaatt
ataattcaagagcatccatttttagaagtaaaaacctcgatgccggagataaagcaagaa
gaaaacatagtgtataaagctatttcgttgtttgaaagttatacaggcatagaacaaaat
ttacaggttattattgagaaaaacatcccggttggtggtggtcttggcggtggaagttct
aacgctgctactgttttaaattatctaaataaaaaacatgacaatatcctgccggaagaa
aaattatttgaaattgctgtcaagcttggtgctgatgttccgtttttcttaaaaggtggt
tttgctataggagaaggcataggagaaaaacttacatttttaccaaaaactttaaacgag
gaaatctttataatctatcctaacataaagtcggacacaaaaactgtatactccaaggtt
gataaatctatattgacaaataaaggagatttaaatataatattatctctgattaatgaa
tacgatataaagaaattagaagcttacattgagaataagttaggtaatatagccttagat
ttgtatccagagataaaagaagcttatgattttttaaattatttaggattttcaccgaaa
gtatccggtagtggcagctgtgtgtacgtaataggaaggccaactgcagaagttgaaaaa
gctgcagccattaaaggttggagattaataaaaacgaaactcaaataa

DBGET integrated database retrieval system