KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0319Help
Entry
SYO3AOP1_0319     CDS       T00715                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYO3AOP1_0319
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYO3AOP1_0319
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYO3AOP1_0319
Enzymes [BR:sul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYO3AOP1_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(326878..327642)
Genome map
AA seq 254 aa AA seqDB search
MIGKVFEIKKPLICYFMAGYPSVEDSIKTAEVLLENGADILEVGFPFSDPVADGITIQAA
HEKAVKDGITPVKVFEITKTIKERFPDKPLIAMTYYNPIFKMGEENFCKIAKENGVDGLI
VPDLPPEEGESLKKIANQYGLSVIFLLAPTSHEKRIKLVSNMSDDFIYYVSITGITGERE
SLPWQELKNKVEEIKKMTDTKIAVGFGVSKGEHAKIISSFADGVIVGSAIVKLQGKKDFE
GLKSLVKELHDSIS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgataggaaaagtatttgagattaaaaaaccgcttatttgctactttatggcaggatat
ccatctgttgaagacagtatcaagacagcagaagttttattagaaaatggtgccgatatt
ttagaagttggatttcctttttcagacccggttgctgatggcattacaatccaagcagcc
cacgaaaaagctgtaaaagatggtattacaccggttaaagtctttgaaattacaaaaact
ataaaagaaagatttccggacaaaccacttatcgcaatgacatattacaacccaattttt
aaaatgggagaagaaaatttttgcaagatagcaaaagaaaatggtgttgacggattgatc
gttccagatttaccaccggaagagggagaaagcttaaaaaaaatagcaaatcagtatgga
ttatctgtgatctttctgcttgctccaacatcacatgaaaaaaggattaaacttgtttca
aacatgagtgatgattttatatattacgtatcaattacaggaattacaggggaaagagaa
agtttgccatggcaagaactcaaaaacaaagtagaagagattaagaaaatgacagataca
aaaattgctgttggatttggtgtttcaaagggagaacatgctaaaattatatcaagtttt
gcagatggtgttatagttggaagtgcgatagtaaaattacaaggtaaaaaagattttgaa
ggattaaaatctttggtgaaggagctacatgatagcattagttga

DBGET integrated database retrieval system