KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0346Help
Entry
SYO3AOP1_0346     CDS       T00715                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Brite
Enzymes [BR:sul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SYO3AOP1_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(359986..360783)
Genome map
AA seq 265 aa AA seqDB search
MEFSIVNNNEKAVLLLHGLTGTPLELRWVARDFSKENYDVYFPILPGHCSSLEEIKNIKW
QDLYRFTKDYYLSLKAKYKHVFVGGLCVGGMLSLILAMDFPDIDAVASWSPAMDIDGWAI
PWYRFLLPFVLHSPLKHLYYWKESDPYGIKNESMRRKIKQMMEREENFGAYDKIPATTIL
ELNRMSKYIKQNINRLTAPLIIIHSKEDDLSSIKGAKFIYEKAPSKIKKFVELTNSYHII
TMDNERDIVSKETISFFNSLLKEKS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttggagttttctatcgtaaacaataacgaaaaagcagtactgctacttcacggccttaca
ggaacgccgttagaattaagatgggtagcaagggatttttcaaaagaaaattatgatgta
tactttccgatactacccggtcattgctcttctttagaagaaattaaaaatataaaatgg
caagatttgtacagatttacaaaagattattatctttcattaaaagccaaatataagcat
gtttttgttggtggattgtgcgttggcggtatgctatctttaattcttgctatggatttt
ccggatattgacgcagtagcatcgtggtctccagccatggacattgatggctgggcgata
ccatggtacagatttttactgccttttgtgttgcattctcctttaaagcatttgtattac
tggaaagagtcagacccttatggtataaaaaacgaatctatgagaagaaaaataaagcag
atgatggaaagagaagaaaattttggagcttatgataaaatacctgctaccacaatatta
gaactaaacagaatgtcaaaatatatcaaacaaaacatcaatcgcttgacagcaccttta
ataataattcattccaaagaagacgacctttcttctataaaaggggcaaagtttatatac
gaaaaagcaccaagcaagataaaaaaatttgtagagcttaccaacagctatcacataata
acaatggataacgaaagggatattgtatcaaaggagactatatcattttttaacagcctc
ttaaaagagaaaagttaa

DBGET integrated database retrieval system