KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0378Help
Entry
SYO3AOP1_0378     CDS       T00715                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00260  Glycine, serine and threonine metabolism
sul00750  Vitamin B6 metabolism
sul01100  Metabolic pathways
sul01110  Biosynthesis of secondary metabolites
sul01120  Microbial metabolism in diverse environments
sul01230  Biosynthesis of amino acids
Module
sul_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYO3AOP1_0378
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SYO3AOP1_0378
Enzymes [BR:sul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SYO3AOP1_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACD66022
JGI: SYO3AOP10378
UniProt: B2V7U9
Position
complement(393152..394222)
Genome map
AA seq 356 aa AA seqDB search
MGCKWKGIIEAYRQYLPVNENTPIITLHEGNTPLIKADNLSKEIAPNLNLQIYLKYEGLN
PTGSFKDRGMTMAISKAKENGKEAVICASTGNTSASAAAYAAKAGMRAYVLLPKGAVAIG
KLSQAMVYGAKIIAVMGNFDDALEIVREIGEKYPVEVVNSVNPYRIEGQKTAAFEICDYL
EEAPDFHFIPVGNAGNITAYWKGYKEYHQLGKVKKLPRMIGWQAEGAAPIVKGFPIKNPQ
TIATAIKIGNPYSWQPALQAARESNGFIDAVSDDEILYAYKLVASTEGVFCEPASAASVA
GVIKSVKKGLFKGGEVITCTLTGNGLKDPDTVIKASEKPVELPPNLEEIARFLELI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgggttgtaaatggaaaggaatcatagaagcatacagacagtatctaccagttaatgaa
aatactccaatcataacgcttcatgaaggaaacacaccacttataaaagctgataattta
tcaaaagaaatagcgccaaacttaaatttacagatttatttaaaatatgaaggacttaat
ccaaccggttcttttaaagaccgtggaatgactatggcaatttcaaaagcgaaagaaaat
ggaaaagaagctgtaatctgtgcatctaccggaaacacttctgcatctgcggcagcctat
gcagcaaaagccggaatgagagcatacgttttacttccaaaaggagctgttgccatagga
aaattatcccaagcaatggtatacggagcaaaaataatagcggttatgggaaattttgac
gatgccttagaaattgttagagaaataggagaaaaatatcctgttgaagttgtaaactct
gtaaatccttacagaatagaaggacaaaaaacagcagcatttgagatttgcgattacctt
gaagaagcaccagactttcattttatacccgttggtaatgcaggaaacattacagcatac
tggaaaggatataaagaataccatcaacttggaaaggttaaaaaacttccaagaatgata
ggatggcaagcagaaggagcagcaccaattgtaaaaggatttcctataaaaaatccacaa
acaatagcaacagcaattaagataggcaatccttacagctggcagccagcactacaagca
gcaagagaaagtaatggttttatagacgcagtctctgatgatgaaattttatatgcttac
aaacttgtagcatcaacggaaggtgtattttgcgagccggcatctgctgcatcagtggca
ggagtgataaaatctgttaaaaaaggtttatttaaaggtggagaagttatcacttgcaca
cttacaggaaatggacttaaagacccggacacagtaataaaagcaagtgaaaaaccggta
gaactcccaccaaacttagaagaaatagcaagatttttagaactaatatga

DBGET integrated database retrieval system