KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0397Help
Entry
SYO3AOP1_0397     CDS       T00715                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00010  Glycolysis / Gluconeogenesis
sul00030  Pentose phosphate pathway
sul00051  Fructose and mannose metabolism
sul00052  Galactose metabolism
sul00680  Methane metabolism
sul01100  Metabolic pathways
sul01110  Biosynthesis of secondary metabolites
sul01120  Microbial metabolism in diverse environments
sul01130  Biosynthesis of antibiotics
sul01200  Carbon metabolism
sul01230  Biosynthesis of amino acids
sul03018  RNA degradation
Module
sul_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYO3AOP1_0397
   00030 Pentose phosphate pathway
    SYO3AOP1_0397
   00051 Fructose and mannose metabolism
    SYO3AOP1_0397
   00052 Galactose metabolism
    SYO3AOP1_0397
  Energy metabolism
   00680 Methane metabolism
    SYO3AOP1_0397
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SYO3AOP1_0397
Enzymes [BR:sul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYO3AOP1_0397
Protein phosphatases and associated proteins [BR:sul01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SYO3AOP1_0397
Messenger RNA biogenesis [BR:sul03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SYO3AOP1_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACD66040
JGI: SYO3AOP10397
UniProt: B2V7W7
Position
complement(414801..415775)
Genome map
AA seq 324 aa AA seqDB search
MKKIGLLTSGGDCPGLNACIRAVVRTANYYNIEVVAFKRGFKGLIENDFTTLDYKSVAGI
LQKGGTILLTAREPRFKDYNFRKIAYENIQKHNIEALFVIGGNGSFQGAYLLQKDFGLNI
IGIPKTIDNDIYGTDYAIGFDTAVNNAMEAIDKIKDTTMSHERIFIVEVMGRDNGFIALE
VGIAVGAELTLIPEYPFPLHVIEETILKAKEMGKNFAIIVLAEGVASAKELSEILNERLK
DKDVGEIRYQVLGYIQRGGSPSAYDRVMASKFGVFAVEKFVQGEKNFMVAYENGKLLTKP
LEISFNKVRIPNLEEYQINNILSM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcggattacttacaagcggtggagactgccctggtcttaacgcatgcatt
agggcagttgttagaactgctaattactataatattgaagttgtagcttttaaaagaggt
tttaaaggtcttatagaaaacgattttacgaccttagattacaaatctgttgcaggtatt
ttacaaaagggaggaactattcttttaactgcaagagagccaagatttaaagattataat
tttagaaaaatagcttatgaaaatatacaaaaacataatatagaggcattgtttgtgatt
ggtggtaatggaagctttcaaggtgcttatttactgcaaaaagattttggactaaacatc
ataggaattccaaaaactattgacaatgatatttatggaacagattatgcaatagggttt
gatacagctgtaaataatgctatggaagcaatagataaaataaaagacacaaccatgtcc
catgaaagaatctttattgtagaagtgatgggaagagataacggatttatagcattagaa
gtaggtattgctgtaggagcggaattaacattaataccagaatatccatttccgcttcat
gtaattgaagaaacaatcttgaaagcaaaagaaatggggaaaaactttgcgataattgtt
cttgctgaaggtgttgcatcagcaaaagaactttctgaaatactaaacgaaagattaaaa
gacaaagatgttggagaaattagatatcaggttcttggatacatacaaaggggtggtagt
ccttcagcatacgatagagtaatggcttcaaaatttggagtttttgctgttgaaaaattt
gttcaaggtgagaagaattttatggttgcctatgaaaatggtaaacttcttacaaaacca
ctggaaattagctttaataaagttagaattccaaatcttgaagagtatcaaataaataac
attctatctatgtaa

DBGET integrated database retrieval system