KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0426Help
Entry
SYO3AOP1_0426     CDS       T00715                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SYO3AOP1_0426
Enzymes [BR:sul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SYO3AOP1_0426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
441112..441687
Genome map
AA seq 191 aa AA seqDB search
MNDIIQQIIFTGRVLHELKLVSSHGGNLSIKDGEYLYITKTGRMAGFLTEEDIIKLPIHK
ETEQDKEASIELIVHRQIYKDNPSINAVVHAHPITATALGYFLREFIPMDIEGELFIKKV
PILEVEKPSASLELAIGVSKLFQEGYKICIVKNHGSFSAGKTINEALKYTSTLENSAEIF
YKWMTLKKMQS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgatataatccagcaaataatcttcaccggaagagttttacacgagttaaagctc
gtatcatcccatggtggaaatcttagcataaaagatggagaatatctttacatcacaaaa
acaggaagaatggcaggctttttgacagaagaagatattataaagcttccaatccacaaa
gaaacagaacaagataaagaagcatcgatagagcttatcgtccacagacagatctataaa
gacaatccaagcataaatgcagtagtccatgctcatccaatcacagccacagccttgggc
tactttctaagagaatttataccaatggatatagaaggagaattattcataaaaaaagta
ccaatcttagaagtagaaaaaccatcagcgtccctagagcttgctattggcgtaagtaaa
ttatttcaagaaggttataaaatctgcatagtcaaaaatcacggctcattttcggcggga
aaaaccatcaatgaagcgttaaaatatacatcaaccttagaaaattcagcggagatattc
tacaaatggatgactctaaaaaagatgcagtcataa

DBGET integrated database retrieval system