KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0602Help
Entry
SYO3AOP1_0602     CDS       T00715                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SYO3AOP1_0602
Enzymes [BR:sul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SYO3AOP1_0602
    3.5.1.-  
     SYO3AOP1_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(618864..619442)
Genome map
AA seq 192 aa AA seqDB search
MRVKLTDRDALVVVDMQNDFMPYGVLPVKDADKIVPTINKYIEKFENKGLPVFFTRDWHP
ENHISFKGFGGIWPPHCVQNTEGAKFHPDLKIPLDNKFIISKGFLQDFDAYSGFQNTVLD
SLLKERGIKRIFVCGVATDFCVKNTAIGGVNLGYQVFLLTDAIKPVFEDKEKEVIDSLLE
KTVVAVELEDLE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaagcttacagatagagacgctttagttgtagttgatatgcaaaatgatttt
atgccgtatggagttttgcctgtaaaagatgctgacaaaatcgttccaacgataaacaaa
tacatagaaaaatttgaaaataaaggacttcctgttttctttacaagagattggcatccg
gaaaatcatatatcttttaaaggatttggcggaatatggcctcctcattgcgttcaaaat
acagaaggtgcaaagtttcatccagacttaaaaattccattagacaacaaatttatcatt
tcaaaaggttttttacaagattttgatgcttactcaggttttcaaaatacagttttagat
agcttattaaaagaaagaggaataaaaagaatatttgtttgtggtgtggcaacagatttt
tgtgtaaaaaacacagctattggcggtgtaaatcttggatatcaagtatttttactaact
gatgcgattaagccggtttttgaagataaagagaaagaagtgatagacagtcttttagaa
aaaacagttgtagcagtagagcttgaagatttagaatga

DBGET integrated database retrieval system