KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0613Help
Entry
SYO3AOP1_0613     CDS       T00715                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYO3AOP1_0613
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYO3AOP1_0613
   00020 Citrate cycle (TCA cycle)
    SYO3AOP1_0613
   00620 Pyruvate metabolism
    SYO3AOP1_0613
   00640 Propanoate metabolism
    SYO3AOP1_0613
   00650 Butanoate metabolism
    SYO3AOP1_0613
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SYO3AOP1_0613
   00680 Methane metabolism
    SYO3AOP1_0613
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SYO3AOP1_0613
Enzymes [BR:sul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SYO3AOP1_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(628502..629692)
Genome map
AA seq 396 aa AA seqDB search
MPTKVIALTGNQAAAEAMRQINFDVAAVYPISPQTELMGFFAEYVANGEVDTDMVAVEGE
HSAMAACIGAAAAGARVITASAGPGIAYMVENLYIASGMRLPIVLIDVNRALSAPLSIHC
DHADSMLTRDTSWISIFSENAQEAYHNLIMSVKIAEKTMFPVIVNYDGYIVSHSIENVEV
LDDETVRNFVGPSGIHRIPYPLLDVSKPVTYGATAQPDYYTECKYQQHVDFLKVYDIFRE
VAQEFESISGKYYDFIEEYMTDDAEYIGISMGSSFGTLKDAVNALRAQGRKVGAIKIRLY
RPFPVKEVARALSNAKGVAVFDRADSFDGIGGPLFKDIASAVFHNQNRPLIHNFIYGLGG
REIHEEEFMKAFDRVERLEKGVESRDYLVEYLQARA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaaaagtaatcgcgttaacaggtaatcaggctgcagctgaagcaatgaggcaa
attaactttgatgtagctgcagtttatccaatatctccacaaacagaattaatgggattt
tttgcagaatatgttgcaaatggtgaagtagatacagatatggttgctgtagaaggcgaa
cactcagcaatggctgcatgtatcggtgctgcagcagccggagcaagagtaataacagct
tcggcaggtccgggtattgcgtatatggttgaaaacttatacatagcttctggtatgaga
ttaccaatagttttaattgacgttaatagagcattatccgctcctttatctatccactgc
gaccatgcggattcaatgctaacaagagacacaagctggatttctattttctcagaaaat
gctcaagaggcatatcacaatcttattatgtctgtaaaaatcgcagaaaaaacaatgttc
ccagtaattgttaactatgatggatatatagtttctcactctatcgagaacgtggaagtc
ctcgatgatgaaacagtaagaaattttgtaggaccatccggcatccacagaatcccttat
ccattgctagatgtatctaaacctgtaacttatggagcaaccgcacagccagactattac
acagaatgtaaatatcaacaacacgtagatttcttaaaagtatacgatattttcagagaa
gttgcacaagagtttgaatccatcagcggaaaatattatgatttcatagaagagtatatg
acggatgatgcagagtacattggaatttccatgggttcttcttttggtacattgaaagat
gcagttaatgcactaagagcacaaggtagaaaggttggagctattaaaattagattatac
agaccattccctgtaaaagaggtagcaagagctttatctaatgctaagggtgttgctgta
tttgatagagcagactcttttgatggaattggcggtccattgtttaaagatattgcatct
gcagtattccataatcaaaatagaccattaatccacaattttatttatggtttaggtggt
agagaaattcatgaagaagaatttatgaaagcctttgatagagttgaaagacttgaaaaa
ggcgttgaatcaagagattatttagtagaatacttacaagcgagggcgtaa

DBGET integrated database retrieval system