KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0620Help
Entry
SYO3AOP1_0620     CDS       T00715                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYO3AOP1_0620
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SYO3AOP1_0620
   00640 Propanoate metabolism
    SYO3AOP1_0620
   00660 C5-Branched dibasic acid metabolism
    SYO3AOP1_0620
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SYO3AOP1_0620
Enzymes [BR:sul01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SYO3AOP1_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(637148..638317)
Genome map
AA seq 389 aa AA seqDB search
MKVHEHQAKEIFRKYGLPVPRGYPAFDVKEAVEAAEELGTWPVVVKAQIHAGGRGKAGGV
KLAKSIEEVQQIASELLGKKLATFQTGPEGLPVSRLYIEEATAIDKEFYVAITLDRSKSK
PIIMVSAAGGMEIEEVAATNPEAIITQTIEPFIGLRSYHARELALKLGLPKNLLNKAASI
FTTLYKIYIELDASMVEINPLVLTKDGNIVILDAKIEFDDNGLFRHPEIMEMDDPTQISP
LEVEAKKFNLNYIKLDGNIACMVNGAGLAMSTMDTIKLAGGEPANFLDVGGSANATQIAN
AFKIILSDPNVKAIFINIFGGILRCDRLAEGIITAAKEVSINVPVIVRMEGTNVELGKKM
LQESGLPLITADTMWEGALKAVEAANKQQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtccatgaacatcaggcaaaagagatttttagaaagtatggtctaccggtacca
agaggttatccggcttttgatgttaaagaggctgttgaagcagcagaagagcttggaaca
tggccggttgttgtgaaagcccaaattcacgcaggcggtagaggaaaagccggtggtgtt
aaacttgcaaaatctatagaagaggttcaacaaatagcatcagagttacttggtaaaaag
cttgctacattccaaacaggaccggagggtttaccggttagcagattatatatagaagaa
gctacagcaatagacaaagagttctatgtggctattacacttgacagaagtaaatctaag
ccaattatcatggtttctgctgctggtggtatggaaatagaagaagtagcagcaacaaat
ccggaggcaattattacccaaacaatagaaccattcataggattaagaagctatcatgca
agagagcttgctttaaaacttggtcttccaaaaaatctattaaacaaagctgcatcaatt
tttacaactctttataagatttatatagagttagatgcttcaatggttgaaataaatcca
ttagttttaacaaaagatggaaatattgttattcttgatgcaaaaatagagtttgatgat
aacggattgtttagacatccagaaattatggaaatggacgacccgactcaaatttcgccg
ttagaagtagaagctaaaaaattcaacttaaactacataaaattagatggaaatattgca
tgtatggttaacggtgcaggccttgcaatgtcaactatggacacaatcaagcttgctggt
ggagaacctgcaaacttcttagatgtgggtggttctgcaaacgcaacccaaatagcaaac
gcatttaaaataatcctctcagaccctaacgtaaaagcaatatttataaatatttttggt
ggtattttaagatgtgatagacttgcagagggtattatcactgctgcaaaagaagtatct
ataaacgttcctgtaatcgttagaatggaaggaacaaacgtagaacttggtaaaaagatg
cttcaagaatcaggattgccattaattactgctgatacaatgtgggaaggtgcattaaaa
gcagtagaagcagcaaataaacaacagtaa

DBGET integrated database retrieval system