KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0738Help
Entry
SYO3AOP1_0738     CDS       T00715                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYO3AOP1_0738
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SYO3AOP1_0738
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SYO3AOP1_0738
Enzymes [BR:sul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SYO3AOP1_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
767280..768632
Genome map
AA seq 450 aa AA seqDB search
MLLSRREFISLSLSTLYLLTHNLEVLASDAVEIFDLGIASGDPTQDGIILWTRINPNIHN
QLKKDLILEISQSPEMKESSVIKIPGYEIIKERDCTIRLTIDNLKPGQTYYYRFTYADVP
SMVGRFKTLPVGDVENYRIGFVTCQNYADGYYTAYRHLANEDIGFILHLGDQIYERIYGK
PRVPGRNLAFPSGHSIALDLEDYKYLYTTYLSDKDYQLARAMHPFIYIWDDHEYANDYSF
DYEKGFYKLPKHPFENDREKVLNLRKAAILAWYFYTPSRAKLNLNAQNPLEWIIIYRDFK
IGELAHLICLDERSYRTSQPCDKRYASAGCEDQYKTSMLGENQKFWFYEKLKQGNSWKIV
ANEVQFVQGKINGLYGSLDAWDGYIKERQEIIEFLNKNNINKFVALTGDRHAGLIAEIPT
EFKENYEKIVGVEFMTPAISSISAAEANWW
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcttttaagcagaagagagtttataagcttatcattatcaaccttatatttacttaca
cataaccttgaagtattggcaagtgatgcagtagaaatttttgaccttggaattgcaagc
ggagacccaacgcaggatggcattatattatggacgagaattaatccaaatatccacaac
caattaaaaaaagaccttatcttagagatatcacaaagtccagagatgaaagaatcatca
gtcataaaaatacccggatatgagattataaaagaaagagactgcacaatcaggctaaca
atagacaatctaaaaccaggacagacttactactacagatttacatacgcagacgttccg
tcaatggtaggtaggtttaaaactctgccggttggagatgttgaaaactacagaatagga
tttgttacctgtcaaaactacgccgatggatattatacagcatacagacatttagccaat
gaagatataggatttatcttacatcttggagaccaaatttatgagagaatctatggcaaa
ccaagagtacccggcagaaatttagcttttccatcaggtcatagtattgcacttgattta
gaagattataaatatctgtatacaacatatttgtcagacaaagattatcagcttgcaaga
gcaatgcatccatttatctatatctgggatgaccatgaatatgcaaacgattactcattt
gactacgaaaaaggattttataaacttccaaaacatccttttgaaaatgacagagaaaaa
gttcttaacctaagaaaagctgcaatattagcatggtatttttatacaccttcaagggct
aaattaaatcttaacgctcaaaatcctttagaatggatcatcatttatagagatttcaaa
attggagaattagcacatttgatttgcttagatgaaaggtcttacagaacatcgcaacct
tgcgataaaagatacgcatccgcaggttgtgaagaccagtataaaacctcaatgcttgga
gaaaatcaaaaattctggttttatgaaaagctaaaacaaggaaatagttggaaaatagta
gctaatgaagtccaatttgtacaaggaaaaataaacggactttatggctccttagatgct
tgggatggatatataaaagaaagacaagagataatagaatttttaaacaaaaataatata
aacaaatttgtagcccttacaggagatagacacgccggcttgattgcagaaatacctaca
gaatttaaagaaaactatgagaaaatcgtgggagtagagtttatgactcctgcaatatcc
tcgatctctgcagcagaagccaactggtggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system