KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0755Help
Entry
SYO3AOP1_0755     CDS       T00715                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYO3AOP1_0755
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYO3AOP1_0755
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYO3AOP1_0755
Enzymes [BR:sul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYO3AOP1_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
786714..787958
Genome map
AA seq 414 aa AA seqDB search
MKYTYPNEKGYFGVFGGKYLPETLMPALEELEQQYLKIKNDGDFKRQLLYYLTEYAGRPT
PLYFASRLTDVVGGAKIYLKREDLLHTGAHKINNTLGQVLLTKKIGKKRIIAETGAGQHG
VSTATAASLFGLECTIYMGEEDAERQALNVFRMKLLGAEVKIVKAGSRTLKDAVNEALRD
WVTNVKTTHYIIGSALGPHPFPMIVRDFQSVIGEEVKQQILEIEGKLPDVIVACVGGGSN
AIGIFYPFIEDTQVRLVGVEAGGYGIETGMHAASINGGTIGVLHGMKSYFIQDEWGQIES
THSISAGLDYPGVGPEHAFLKEIKRAEYITATDEEALEGFLLLSRTEGIIPALESSHAII
KAVEIAKSLDKSKSVVINLSGRGDKDVQSVKNLLDTDKELYERLLSRLKEKYGV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacatatccgaatgaaaaaggatactttggagtatttggcggtaaatactta
ccagaaacactcatgccagctttagaagaattagaacagcagtatttaaaaatcaaaaac
gatggggactttaaaagacagcttttatactatcttacagagtatgcaggtagaccaacg
cctttatattttgcatcaagactaactgatgttgttggtggagcaaaaatttatttaaaa
agagaagacttattacatacaggagcccataagataaataatacacttggacaggtcctg
cttacaaaaaaaattgggaaaaaaagaattatagcagaaactggggcaggacagcacggc
gtttcaacagcaacggctgcatctttgtttggtttagaatgcactatttatatgggtgaa
gaagacgcagaaaggcaggcgttaaacgtttttagaatgaagctgcttggagcagaagtt
aaaatagtaaaagctggtagcagaactttaaaagatgctgttaatgaagcattgagagac
tgggttactaatgttaagacaacccattacattatcggttcagcacttggaccccatcct
tttccgatgattgttagagatttccaatctgtgataggcgaagaagtaaaacagcaaata
cttgaaatagaaggaaaattgcctgatgttatagttgcatgcgttggtggaggaagtaat
gcaataggtattttttatccttttatcgaagatacacaggttagacttgttggagtagag
gcgggcggttatggaatagaaactggcatgcatgcagcaagtataaacggtggtaccatt
ggagtacttcatggaatgaaatcttactttattcaagatgagtggggacaaatagaatca
acccattcaatttctgccggattagactatccgggcgttggtccggaacatgcatttttg
aaagaaattaaaagagctgagtatattaccgcaacagatgaagaagcattagaaggattt
ttattactatcaagaacagaaggaataatacctgcattagaaagctcccatgctattata
aaagcggtagaaattgcaaaaagcttagacaaatctaaatccgttgttataaatctatca
ggaagaggagataaagacgttcaatcagtaaaaaatcttcttgatacagataaagagttg
tatgaaagattgttaagcagattaaaagaaaagtatggggtttaa

DBGET integrated database retrieval system