KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0759Help
Entry
SYO3AOP1_0759     CDS       T00715                                 

Definition
tRNA synthetase valyl/leucyl anticodon-binding
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sul00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SYO3AOP1_0759
Enzymes [BR:sul01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     SYO3AOP1_0759
Amino acid related enzymes [BR:sul01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SYO3AOP1_0759
Transfer RNA biogenesis [BR:sul03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SYO3AOP1_0759
 Prokaryotic Type
    SYO3AOP1_0759
Mitochondrial biogenesis [BR:sul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SYO3AOP1_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
792258..793121
Genome map
AA seq 287 aa AA seqDB search
MERKTIKEILEENHLNLNDNAVLLFDKLGLDKSVLTKLEDAYGKSDKMSKSKHNTVDPDE
MVKKYGADTVRLYTLFAAPPENNFDWTESGIEGAHRFVKRLFYYISENLDLVKNISYSEE
DFKNLSQESLNIRKKLHQTIKKVRSDIERFQFNTAIASMMELLNTLYDYKEKNPKVLREV
FEKFILLISPFTPFMADYLWRQLGNKGYTIQQPFPNYDESLLVEKEKEIPVQINGKLRAT
IKAPVDASQDEVLNIALKDESVKKWIEGKEIVKTIFIQGKILNIVVK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaaacgattaaagaaatactagaagaaaatcatttaaatcttaatgataat
gcagttttactttttgataaattaggattagataaatcggttttaaccaagcttgaagat
gcttatggaaaatcagataaaatgtctaaatctaaacacaatacagtcgacccggatgaa
atggtaaaaaagtatggtgctgacactgttagactttacacactatttgctgcaccgcca
gaaaacaattttgattggacagaaagcggaatagaaggggctcatagatttgtaaaaagg
ctattttattacatttcagaaaatttagaccttgttaaaaatatatcttacagtgaagaa
gattttaaaaatctttcacaagaaagtctaaatataagaaaaaaacttcatcaaaccatt
aaaaaagtaagaagcgatatagaaaggtttcagtttaacacagccattgcttccatgatg
gagctcttaaataccctttatgattataaagaaaaaaatccaaaagtattaagagaagtc
tttgagaaatttattcttttaatctctccatttactccatttatggctgattatctatgg
agacagcttggaaataaaggatatactatacagcaaccgttcccaaactatgatgaaagt
ttattagtagaaaaagaaaaagaaattccggtccagataaatggcaaattaagggcaaca
atcaaagctcctgtagatgcttctcaggatgaagttttaaacatcgctttaaaagatgaa
tctgttaaaaaatggattgaaggaaaagagattgttaaaactatctttattcaagggaag
attttaaacattgttgttaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system