KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0759Help
Entry
SYO3AOP1_0759     CDS       T00715                                 

Definition
tRNA synthetase valyl/leucyl anticodon-binding
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sul00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
792258..793121
Genome map
AA seq 287 aa AA seqDB search
MERKTIKEILEENHLNLNDNAVLLFDKLGLDKSVLTKLEDAYGKSDKMSKSKHNTVDPDE
MVKKYGADTVRLYTLFAAPPENNFDWTESGIEGAHRFVKRLFYYISENLDLVKNISYSEE
DFKNLSQESLNIRKKLHQTIKKVRSDIERFQFNTAIASMMELLNTLYDYKEKNPKVLREV
FEKFILLISPFTPFMADYLWRQLGNKGYTIQQPFPNYDESLLVEKEKEIPVQINGKLRAT
IKAPVDASQDEVLNIALKDESVKKWIEGKEIVKTIFIQGKILNIVVK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaaacgattaaagaaatactagaagaaaatcatttaaatcttaatgataat
gcagttttactttttgataaattaggattagataaatcggttttaaccaagcttgaagat
gcttatggaaaatcagataaaatgtctaaatctaaacacaatacagtcgacccggatgaa
atggtaaaaaagtatggtgctgacactgttagactttacacactatttgctgcaccgcca
gaaaacaattttgattggacagaaagcggaatagaaggggctcatagatttgtaaaaagg
ctattttattacatttcagaaaatttagaccttgttaaaaatatatcttacagtgaagaa
gattttaaaaatctttcacaagaaagtctaaatataagaaaaaaacttcatcaaaccatt
aaaaaagtaagaagcgatatagaaaggtttcagtttaacacagccattgcttccatgatg
gagctcttaaataccctttatgattataaagaaaaaaatccaaaagtattaagagaagtc
tttgagaaatttattcttttaatctctccatttactccatttatggctgattatctatgg
agacagcttggaaataaaggatatactatacagcaaccgttcccaaactatgatgaaagt
ttattagtagaaaaagaaaaagaaattccggtccagataaatggcaaattaagggcaaca
atcaaagctcctgtagatgcttctcaggatgaagttttaaacatcgctttaaaagatgaa
tctgttaaaaaatggattgaaggaaaagagattgttaaaactatctttattcaagggaag
attttaaacattgttgttaagtaa

DBGET integrated database retrieval system