KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0857Help
Entry
SYO3AOP1_0857     CDS       T00715                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SYO3AOP1_0857
   00052 Galactose metabolism
    SYO3AOP1_0857
   00500 Starch and sucrose metabolism
    SYO3AOP1_0857
   00520 Amino sugar and nucleotide sugar metabolism
    SYO3AOP1_0857
Enzymes [BR:sul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SYO3AOP1_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
895419..896318
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPVAGFGTRFLPATKSTPKEMMPLIDKPIIHYIVEEAVNSGIETIIFVTGRH
KRAIEDYFDYYPELEQVLNKSGKEKEIEMLRQISNMAEFVFIRQKQQLGLGHAVLTAANL
VGNEPFAVLLGDEIIKNDEKPGIKQLIDIYYQFGKSVIGTMEVPKEDVSKYGIVAGKEVI
NGIKIIESLIEKPSVEEAPSTTAIIGRYVLTPNVFDALRETPIGRGGEIQLTDGLSKLRE
KEVIYAKDIEGIRHDTGNKLGYIEAIIDFALDRQDLKDEVFKMIKEKYKEMEKDSVEQN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcagaaaagctgtaataccagttgcaggctttggaacaagatttttacca
gctacaaaatccacaccaaaagaaatgatgccattaatagacaagccaattattcattac
attgtagaagaagctgtaaactctggaatagaaactataatttttgttacaggaagacat
aaaagagcaatagaagattactttgattactatccagagttagaacaggttttaaataaa
agtggaaaagaaaaagaaattgaaatgcttagacaaataagtaatatggcagaatttgta
tttatcagacaaaaacagcagcttggactggggcatgcagtattaactgcagcaaattta
gtcggcaatgaaccatttgcggttttacttggagatgagattattaaaaacgatgaaaag
ccaggaataaaacagcttatagatatttactatcagtttggaaaatcagtaataggcacg
atggaagtaccaaaagaagatgttagtaagtatgggatagtagcgggaaaagaagtcata
aatggaataaagattattgaatcattgattgaaaaaccatcggtagaagaagcaccatca
actaccgcaataataggaagatatgtcctaacaccgaacgtatttgatgcattaagagaa
acaccaataggaagaggtggagaaattcaattaacagatggattatcaaagcttagagag
aaagaagtaatttatgcaaaagatatagaaggaattaggcacgacacaggcaataagctt
ggatatatagaagcaatcatagattttgcacttgatagacaagatttgaaagatgaagtc
tttaaaatgataaaagaaaaatataaggagatggaaaaggattcagttgaacaaaattaa

DBGET integrated database retrieval system