KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0982Help
Entry
SYO3AOP1_0982     CDS       T00715                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Brite
Enzymes [BR:sul01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SYO3AOP1_0982
Secretion system [BR:sul02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SYO3AOP1_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1015990..1016874
Genome map
AA seq 294 aa AA seqDB search
MKLKLFFAGLMSAASLVMAAESCLGGGSKVSTSEVQKALSGILGNAKVVSVSNAPISGLY
EVVIESGGRKVPIYIDCNLKYLVNGEIIDINKKVSLTRERFQALQSQANSEKETRLTKIL
GKDKVEMLKKEGLLESVNIVDLKNLPKPNVSYGNGNIKIYVITDPQCPFCAKLHEEIKKV
LAQRKDVSFEMIMYPLPFHKHASGVAQNIICQNDNTAKQKTLDAAFSYTLKNDENGLASL
EKPCNAGKQAVDNNLKYGQANGINGTPTIIFPKGVAISGALPADKLNKLIDILK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaagttattttttgcaggattaatgtctgcagcatcattagtaatggcagca
gaaagttgtttaggtggtggttctaaagtaagtacatcagaagttcaaaaagcactatca
ggtatacttggtaatgcaaaggttgtaagtgtttcaaatgctccaattagcggtttatat
gaagttgttatcgaaagtggtggaagaaaagtaccaatctatattgattgcaatttaaaa
tacttggtgaatggtgaaataatagatattaataaaaaagttagcttgacaagagaaagg
tttcaggcactgcaatcacaagcaaactcagaaaaagaaacaagacttactaagatttta
ggtaaagataaagttgaaatgttaaaaaaagaaggtttattagaatctgttaatatagta
gatttaaagaatttgccaaaacctaacgtaagctatggaaatggaaatattaaaatctat
gttataacagaccctcaatgtccattctgtgcaaaactgcatgaagaaattaaaaaagtc
ttggctcaaagaaaagatgtttcgtttgaaatgattatgtatccattgccgttccataaa
cacgcatctggagtggctcaaaatattatttgtcaaaacgataatacagcaaagcaaaaa
acacttgatgctgcattttcttatactttaaaaaatgatgaaaatgggctggcatctctt
gaaaaaccttgtaatgctggaaagcaagctgtagataacaatctaaaatacggtcaagct
aatggaattaacggaacaccaacgataatcttccctaagggtgtggcaatatccggtgca
ttacctgctgataaattaaataaattgatagatattttaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system