KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1056Help
Entry
SYO3AOP1_1056     CDS       T00715                                 

Definition
ATP citrate synthase subunit 1
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYO3AOP1_1056
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SYO3AOP1_1056
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SYO3AOP1_1056
Enzymes [BR:sul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     SYO3AOP1_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1097720..1099027)
Genome map
AA seq 435 aa AA seqDB search
MAQRGIREYDGKRIIAQNWKDYFGDAFNYEFKSVLVTPETDFDKLPEQYPWLKETPLVAK
PDMLFGKRGKLGLVLYKIEKPGDVKYEDAVKWIKQKMQEEVEINGVKGHLTHFLIEPFVP
HKPEEEYYVSFSMGDDYDTVYMSAFGGIDVEENWDKVVEVHIPPTASDEEIEKLIKANVP
KEIKDREKYGDFVVRAYKMFRDLHFVYFEINPLVMVDNNVYLLDFVGKVDDTAGFVVGKK
WGELEFPSGFGRDLTPEEKYIKELDEKSGSSLKLTILNPEGRIWTLVAGGGASVVYADTV
ADMGYVNDLANYGEYSGNPTRTETREYVKTVLDLMTRSKHPSGKPKILLIGGAIANFTDV
AKTFDGIIDAFKEYADKMRQVGVRIYVRRGGPNYEVGLKRIKQAAEELGLPIEVYGPELH
MTDIVRKALEEEKAA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaggggaattagagaatacgatggtaaaagaatcatcgcgcaaaactggaag
gattactttggtgatgcttttaattatgagtttaaatctgttctcgttacaccagaaaca
gatttcgacaaacttccagagcaatatccatggttaaaagaaactccattagtagcaaag
ccggatatgctatttggtaagagaggaaagcttggattagtcctttacaaaattgaaaaa
ccaggtgatgttaaatacgaagatgcggttaaatggataaaacaaaaaatgcaagaagaa
gtggaaattaatggagttaaaggacatttaacacactttttaatagagccatttgttcca
cataaaccggaggaagagtactatgtctcattctcaatgggcgacgattacgatactgtt
tacatgtccgcttttggtggtatagatgtagaagaaaactgggataaagtagtagaagtt
cacatcccaccaacagcttctgacgaagagattgaaaaactaataaaagctaatgttcca
aaagagattaaagatagagaaaaatatggagattttgttgttagagcttataaaatgttt
agagatttgcactttgtatattttgaaataaacccactcgtaatggttgacaataacgtt
tacttattagactttgttggaaaggttgatgatacagccggttttgttgttggtaaaaaa
tggggagaattagagtttccatcaggatttggaagagatttaacaccggaagaaaaatac
attaaagaattggatgagaagtctggctcatcattaaaattaacaatacttaatccagaa
ggtagaatttggactcttgttgccggtggtggtgcttctgttgtatatgcagatacggtt
gcagatatgggatatgtaaatgatcttgcaaactacggtgaatactcaggaaatccaaca
agaacagaaacaagagagtatgttaaaacagtccttgacttaatgacaagaagcaaacat
ccttccggaaagccaaaaatacttttgatcggtggagcaattgctaactttactgacgta
gctaaaacatttgacggaataattgatgcatttaaagaatacgctgataaaatgagacaa
gtaggtgtaagaatatatgtcagaagaggtggaccaaactatgaagttggattgaaaaga
ataaagcaagctgcagaagagcttggactaccgattgaagtttatggaccagaattacac
atgacagatatagttagaaaagctttagaagaagaaaaagctgcataa

DBGET integrated database retrieval system