KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1125Help
Entry
SYO3AOP1_1125     CDS       T00715                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYO3AOP1_1125
  Amino acid metabolism
   00340 Histidine metabolism
    SYO3AOP1_1125
Enzymes [BR:sul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SYO3AOP1_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1173801..1175087)
Genome map
AA seq 428 aa AA seqDB search
MKIVDLRGRYFKEDESLEFLIKRGDIETEKYEPIVKTIIKEVKERGDEALVEFTEKFDKV
KLNPEDLVIPYEELEKAYNEIEDDVRWAYEVAYERIYEFHENQKEKSFFKEEEGMILGQK
ITPLEVVGLYVPGGKAAYPSSVIMNAAPARVAGIKEIVMCSPNPNKYTLAAAFVCGIDTV
YRIGGAQAVAAMAYGTETVRKVDKIVGPGNIYVALAKKNLYGIVDIDMIAGPSEILVIAD
ETANYKWVAADLLSQAEHDELAASILVTTSEDLAKKVKEYLYTELLKDFPRKEIAEKSLN
VYGHAFIVEDLDTACEVSNYIAPEHLEIITKNPFDLLNKIYHAGAIFLGEYATEPLGDYI
LGPNHVLPTSRAARFSSPLGVYDFIKRSSVIYVSKEGFDRVAKHAINMAKSEGLEAHKLS
VEIRKNNE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgttgatttgagagggagatattttaaagaggatgaaagtctggaatttcta
ataaaaagaggagatatagagacagaaaaatacgaacctattgtaaaaactatcataaaa
gaagtaaaagaaagaggagatgaggctcttgtagaatttacagaaaagtttgataaagtt
aagttaaatccggaagaccttgtaattccatatgaagagcttgaaaaagcatataatgag
atagaagatgatgttagatgggcttacgaagtagcttatgagagaatttatgaatttcat
gaaaatcagaaagagaaatctttctttaaagaagaagagggaatgattcttggtcagaaa
ataacacctttggaagtagttggactatacgttccaggtggcaaggcagcttatccttca
agtgtaatcatgaatgcagctcctgcaagggtagccggcattaaagagattgttatgtgt
tctccaaatccaaataaatacacattggcagctgcttttgtatgtggtatagatactgtt
tatagaatcggtggtgctcaagcagttgctgcaatggcttatggaacagaaacagttaga
aaagttgataaaatcgttggtccgggtaatatatacgtagctttagctaaaaagaattta
tatggaatagttgacatagacatgatagcaggaccttcagaaattcttgtgatagcagat
gaaactgcaaattacaaatgggttgcagcagatttactatctcaagcagaacacgacgag
ctggcagcatccatacttgttacaacgtcagaagaccttgcaaagaaagtaaaagagtat
ttatatacagaactattaaaagattttccaagaaaagaaatagcagaaaaatctttaaat
gtatatggacatgcttttattgtagaagatttagatactgcttgcgaagtttcaaactat
attgcccctgaacacttagaaatcataacaaaaaatccgtttgatttacttaacaaaata
tatcatgctggagcaatattccttggagagtatgcaacagaaccacttggggactacatc
cttggaccaaatcacgtattacctacttcaagagcagcaagattttcatctccccttgga
gtttatgactttataaaaagaagctctgtaatatatgtatcaaaagaaggctttgacaga
gtagcaaaacatgctattaatatggctaagtccgagggtcttgaagctcacaaattaagt
gttgagataagaaaaaataatgaataa

DBGET integrated database retrieval system